DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTNL3 and syg-1

DIOPT Version :9

Sequence 1:NP_932079.1 Gene:BTNL3 / 10917 HGNCID:1143 Length:466 Species:Homo sapiens
Sequence 2:NP_001123159.1 Gene:syg-1 / 180555 WormBaseID:WBGene00006365 Length:730 Species:Caenorhabditis elegans


Alignment Length:545 Identity:106/545 - (19%)
Similarity:170/545 - (31%) Gaps:194/545 - (35%)


- Green bases have known domain annotations that are detailed below.


Human     8 VLSFYELVSG---QWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRD 69
            :|..::||:.   |.::....|...|.|||.|:.:|    ....:...|::.::.|..       
 Worm     9 LLLLFQLVTCQQLQQRIVEAPKDTLAAVGETAILTC----RVEHQQGPVQWMKDDFGL------- 62

Human    70 GEDWESKQMP---QYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQ-----IYDEEAT 126
            |.| ..|.:|   :||     :..|.|.|..:|.:.|:|..|...:.|..|..     :...:| 
 Worm    63 GTD-RDKPLPGNKRYR-----MVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKA- 120

Human   127 WELRVAALGSLPLI-----SIVGYVDGGIQLLCLSSGWFPQPTAKW------------------- 167
             :|.|....:.|.|     |:.......|...|||....|.||..|                   
 Worm   121 -KLTVLVRPTPPKIVKSHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIASDEHGKHIVSWLGESR 184

Human   168 ----------------------KGPQGQDLSSDSRANADGYSLY-----------DVEISIIVQE 199
                                  :..|.::..::||.::..||:.           |.:..|.:.:
 Worm   185 SKFGGIHAKPEISQETVIAHVNETTQVEEGGNNSREDSSIYSIMSNLSFIPRPEDDHKYLICISQ 249

Human   200 N--------AGSILCSIHLAEQSH-EVESKVLIGETFFQPSPWRLASILLGLLCGALCGVVMGMI 255
            :        ..|:..|:..|.|.: .|.||:.:.|.         .|.||.      |.|     
 Worm   250 HMTFPNKIEVDSVKLSLRYAPQINLTVASKLPLREN---------GSALLA------CNV----- 294

Human   256 IVFFKSKGKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPKLCVSDLKTVTHRK-----AP 315
                .:|.....::.|.:  |..:||:...     ||..||         ||...|.:     |.
 Worm   295 ----NAKPLDNVKISWYK--GNQKLRETGD-----TLTFET---------LKMEDHNRDIFCEAT 339

Human   316 QEVPHSEKRFTRKSVVASQGFQA----GKHYWEVDVGQN--------------VGWYVGVCRDDV 362
            .|:     ..||.|:..:..|.|    .....||:.|.|              :.|..|...:.:
 Worm   340 NEI-----GTTRGSIKLNVAFGARIMSTSQDKEVNEGDNAFFHCATLANPAPAIFWTRGDSDEII 399

Human   363 DRGKNNVTLSP----NNGYWVLRLTTEHLYFTFNPHFISLPPSTPPT-----RVGVFLDYEGGTI 418
            ..|: |:||..    ..|.:....|.|........|::.:  ..|||     .|...||..    
 Worm   400 GHGE-NLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHI--RGPPTVSMKDEVSASLDEA---- 457

Human   419 SFFNTNDQSLIYTLLTCQFEGLLRP 443
                        |.:.|:..|  ||
 Worm   458 ------------TEIICEISG--RP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTNL3NP_932079.1 Ig_MOG_like 33..132 CDD:319291 23/106 (22%)
SPRY_PRY_C-I_1 289..461 CDD:293968 39/187 (21%)
syg-1NP_001123159.1 I-set 24..124 CDD:254352 26/118 (22%)
Ig 30..124 CDD:299845 26/112 (23%)
Ig <151..265 CDD:299845 15/113 (13%)
Ig_2 276..353 CDD:290606 26/121 (21%)
IG_like 283..353 CDD:214653 23/114 (20%)
IG_like 363..427 CDD:214653 13/64 (20%)
Ig_2 368..438 CDD:290606 13/70 (19%)
Ig 440..528 CDD:299845 11/47 (23%)
IG_like 450..535 CDD:214653 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.