DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DHRS4 and CG31546

DIOPT Version :9

Sequence 1:NP_066284.2 Gene:DHRS4 / 10901 HGNCID:16985 Length:278 Species:Homo sapiens
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:262 Identity:80/262 - (30%)
Similarity:139/262 - (53%) Gaps:12/262 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    19 MASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQN---VDQAVATLQGEG 80
            |.|.|....| .:.||.|:|.:..|||.|.|...::.||.:.:..|:::.   |.:....:..|.
  Fly     1 MGSKGKAGLD-FSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEP 64

Human    81 LSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAP 145
            ..:.|.:....:.|...|  .|..:..|.:|:||:.|.:.| .|::.......:...::.||::.
  Fly    65 YGIAGDLLKPPEIECIAR--KTTERYEGKLDVLVNGAGIMP-TGTLQSTELACFTHVMEANVRSG 126

Human   146 ALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCL 210
            ..:||.::|:: .:..||:|.|||:......|....||:||.|:...|::||::|.|:.:|||.:
  Fly   127 FYLTKLLLPQL-LQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAV 190

Human   211 APGLIKTSFSRMLWMDKEKE----ESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVG 271
            .||:|:|:..:...||::..    |..|:|..:.|:|||::.|..:.||.||.||::||.|:.|.
  Fly   191 NPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVD 255

Human   272 GG 273
            ||
  Fly   256 GG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DHRS4NP_066284.2 CR_SDR_c 23..278 CDD:187641 78/258 (30%)
fabG 30..273 CDD:235975 74/249 (30%)
Microbody targeting signal 276..278
CG31546NP_730973.1 fabG 9..257 CDD:235975 75/252 (30%)
NADB_Rossmann 11..261 CDD:304358 76/251 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140601
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.