DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DHRS4 and CG12171

DIOPT Version :9

Sequence 1:NP_066284.2 Gene:DHRS4 / 10901 HGNCID:16985 Length:278 Species:Homo sapiens
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:250 Identity:84/250 - (33%)
Similarity:135/250 - (54%) Gaps:13/250 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    32 NKVALVTASTDGIGFAIARRLAQDGAHVVVSSRK----QQNVDQAVATLQGEGLSVTGTVCHVGK 92
            :||.:||.::.|||...:..||:.|..:.:..|.    .:..:|.||......|.|   ...:..
  Fly     6 DKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGAPALQV---AADINS 67

Human    93 AEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEME 157
            ..|.:.:|:..:..||.||:||:||.:.. .|||.:.:.|.:|:.::.||::...:|..|.||:.
  Fly    68 ESDVQGIVSATLAKHGRIDVLVNNAGILE-LGSIENTSLEQFDRVMNTNVRSLYQLTHLVTPELI 131

Human   158 KRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRM 222
            |. .|::|.|||:......||...|||||.|:...|:.:|:||||:.:|||.:.||:|.|...|.
  Fly   132 KT-KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGVIITELQRR 195

Human   223 LWMDKEKE----ESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGG 273
            ..:|:|..    |..|.|..:.|.||.::.|..::||.|::||:.||.::.|.||
  Fly   196 GGLDQEAYVKFLEHAKVTHALGRPGEVKEVAAAIAFLASDEASFSTGISLPVDGG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DHRS4NP_066284.2 CR_SDR_c 23..278 CDD:187641 83/249 (33%)
fabG 30..273 CDD:235975 82/248 (33%)
Microbody targeting signal 276..278
CG12171NP_649563.1 fabG 2..251 CDD:235975 83/249 (33%)
NADB_Rossmann 4..254 CDD:304358 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.