DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CPSF4 and YTH1

DIOPT Version :9

Sequence 1:XP_011514057.1 Gene:CPSF4 / 10898 HGNCID:2327 Length:274 Species:Homo sapiens
Sequence 2:NP_015432.1 Gene:YTH1 / 856222 SGDID:S000006311 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:67/146 - (45%)
Similarity:92/146 - (63%) Gaps:13/146 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    40 VCEFFLK----AACGKGGMCPFRHISG--EKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYF 98
            :|||:..    .:|.:|.:||.:|:..  :..:||:|||||||||.||||:||||::.|||||.|
Yeast    33 ICEFYNSREGPKSCPRGPLCPKKHVLPIFQNKIVCRHWLRGLCKKNDQCEYLHEYNLRKMPECVF 97

Human    99 YSKFGECS-NKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEG-PS 161
            :||.|.|: :.:|.:|||||.|||..|..|:.|||..|..|..||.::|.|..|:.||||.| ..
Yeast    98 FSKNGYCTQSPDCQYLHIDPASKIPKCENYEMGFCPLGSSCPRRHIKKVFCQRYMTGFCPLGKDE 162

Human   162 CKFMQLLVTSPRFELP 177
            |.     :..|:|.:|
Yeast   163 CD-----MEHPQFIIP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CPSF4XP_011514057.1 YTH1 <25..>161 CDD:227416 63/128 (49%)
COG5222 <231..>263 CDD:227547
YTH1NP_015432.1 YTH1 2..208 CDD:227416 67/146 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I1373
Isobase 1 0.950 - 0 Normalized mean entropy S731
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 1 1.000 - - otm52706
orthoMCL 1 0.900 - - OOG6_103251
Panther 1 1.100 - - LDO PTHR23102
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2013
SonicParanoid 1 1.000 - - X2133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.