DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MALT1 and fred

DIOPT Version :9

Sequence 1:NP_006776.1 Gene:MALT1 / 10892 HGNCID:6819 Length:824 Species:Homo sapiens
Sequence 2:NP_608812.3 Gene:fred / 33613 FlyBaseID:FBgn0051774 Length:1447 Species:Drosophila melanogaster


Alignment Length:818 Identity:167/818 - (20%)
Similarity:257/818 - (31%) Gaps:284/818 - (34%)


- Green bases have known domain annotations that are detailed below.


Human   118 VLQLLSPPGIKITVNPESKAVLA--GQFVKLCCRATGHPF-VQYQWFKMNKEIPNGN-TSELI-F 177
            ||.:|.||.:.|    |||...|  |:.|.:.|..|.:|. :..:|.|  :..|:.. |.||: .
  Fly   310 VLDV
LYPPIVFI----ESKTHEAEEGETVLIRCNVTANPSPINVEWLK--EGAPDFRYTGELLTL 368

Human   178 NAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESF-QRSVDGVSESKL---------QICVE 232
            .:|..:.||.|:||..|                |.:.| .:.|:||..|.:         |..:.
  Fly   369 GSVRAEHAGNYICRSVN
----------------IMQPFSSKRVEGVGNSTVALLVRHRPGQAYIT 417

Human   233 PTSQKLMPGSTLVLQCVA--VGSPIPHYQWFKNELPLTHETKKL------YMVPYVDLEHQGTYW 289
            |....:..|:.:.|.|.|  .|.|:|.|:||::.......|:|:      |.:|...|..:|.|.
  Fly   418 PNKPVVHVGNGVTLTCSANPPGWPVPQYRWFRDMDGDIGNTQKILAQGPQYSIPKAHLGSEGKYH 482

Human   290 CHVYNDRDSQDSKKVEII--------------------IGRTDEAVECTEDELNNLGHPDNKEQT 334
            ||..|:...  .|...||                    :|..|.||.|:..     |.|     |
  Fly   483 CHAVNELGI--GKIATIILEVHQPPQFLAKLQQHMTRRVGDVDYAVTCSAK-----GKP-----T 535

Human   335 TDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVD-EF 398
            ......||...:|              |...::::..........||::..:..:..:...: ..
  Fly   536 PQIRWIKDGTEIL--------------PTRKMFDIRTTPTDAGGGVVAVQSILRFRGKARPNGNQ 586

Human   399 LLLLDKGVYGLLY------------------------YAGHGYE--------------------- 418
            ||..|:|:|..||                        |....|:                     
  Fly   587 LLPNDRGLYTCLYENDVNSANSSMHLRIEHEPIVIHQYNKVAYDLRESAEVVCRVQAYPKPEFQW 651

Human   419 NFGNSFMVPVDAPNPY------------RSENCLCVQNILKL--MQEKETGLNVFLLDMCRKRND 469
            .:||:       |:|.            |.||.....:||::  :|..:.|..:     ||..|.
  Fly   652 QYGNN-------PSPLTMSSDGHYEISTRMENNDVYTSILRIAHLQHSDYGEYI-----CRAVNP 704

Human   470 YDD-TIPI-------------LDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLL 520
            .|. ..||             |..|:|..|    ||.......|        ||.||        
  Fly   705 LDSIRAPIRLQPKGSPEKPTNLKILEVGHN----YAVLNWTPGF--------NGGFM-------- 749

Human   521 EDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHE 585
             ..|..|....||        |..:|.|...|.       ...|...:.|:.|...|.:|.:.:.
  Fly   750 -STKYLVSYRRVA--------TPREQTLSDCSG-------NGYIPSYQISSSSSNSNHEWIEFNC 798

Human   586 LPESMCLKFDCGVQIQLGF---------AAEFSNVMIIYTSIVYKPPEIIMCDAYVTDFPLDLDI 641
            ..|:.|............|         .:.:||.::..|.:...||            ||.:..
  Fly   799 FKENPCKLAPLDQHQSYMFKVYALNSKGTSGYSNEILATTKVSKIPP------------PLHVSY 851

Human   642 DPKDANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVN 706
            ||           .|:::..::...||     ||..:.|.||           ..|......|:.
  Fly   852 DP-----------NSHVLGINVAATCL-----SLIAVVESLV-----------TRDATVPMWEIV 889

Human   707 VGKPLIAKLDMHRGLGRKTCFQTCL---MSNGPYQSSAATSGGA----GHYHSLQDPFHGVYHSH 764
            ....|:..       |.:|.|:..:   :|...:.::|.|||.:    |..|..:|....:  :.
  Fly   890 ETLTLLPS-------GSETTFKEAIINHVSRPAHYTTATTSGRSLGVGGGSHLGEDRTMAL--AE 945

Human   765 PGNPSNVTPADSC------HCSRTPDAFI-SSFAHHAS 795
            ...|..|.....|      ||....:|.| .|:..|.|
  Fly   946 TAGPGPVVRVKLCLRSNHEHCGAYANAEIGKSYMPHKS 983

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MALT1NP_006776.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Death_MALT1 42..126 CDD:260053 4/7 (57%)
Ig_2 128..194 CDD:290606 22/70 (31%)
IG_like 133..201 CDD:214653 22/72 (31%)
Ig_2 232..308 CDD:290606 24/103 (23%)
I-set 233..308 CDD:254352 24/102 (24%)
Peptidase_C14 343..560 CDD:279049 49/290 (17%)
Caspase-like 348..562 48/287 (17%)
Nuclear export signal 369..376 0/6 (0%)
fredNP_608812.3 Ig 29..126 CDD:299845
IG_like 141..228 CDD:214653
Ig 147..228 CDD:299845
I-set 232..313 CDD:254352 2/2 (100%)
IGc2 250..302 CDD:197706
IG_like 323..385 CDD:214653 20/63 (32%)
IGc2 330..385 CDD:197706 17/56 (30%)
Ig_2 416..501 CDD:290606 24/86 (28%)
IG_like 418..501 CDD:214653 24/84 (29%)
I-set 505..612 CDD:254352 21/130 (16%)
Ig 526..611 CDD:143165 18/108 (17%)
IG_like 633..715 CDD:214653 17/93 (18%)
Ig 635..713 CDD:143165 16/89 (18%)
FN3 720..838 CDD:238020 29/153 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7699
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.