DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RAB10 and Rab32

DIOPT Version :10

Sequence 1:NP_057215.3 Gene:RAB10 / 10890 HGNCID:9759 Length:200 Species:Homo sapiens
Sequence 2:NP_525109.1 Gene:Rab32 / 35940 FlyBaseID:FBgn0002567 Length:686 Species:Drosophila melanogaster


Alignment Length:207 Identity:72/207 - (34%)
Similarity:116/207 - (56%) Gaps:21/207 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     9 LFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKI-KLQIWDTAGQERFH 72
            |:|:|:||:.|.|||..:.|:....|:..:.:|||:||.:|.::.....| :||:||.||||||.
  Fly   483 LYKILVIGELGTGKTSFIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFG 547

Human    73 TITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHA----NEDVERMLLGNKCDMDDKRVVP 133
            .:|..||:.|:|..:|:|:|...:|:.:|||..::|...    ...:..:||.||||.:.:.::.
  Fly   548 NMTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCILLANKCDQEKQGIIT 612

Human   134 K-GKGEQIAREHGIR-FFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSG------- 189
            : .|.::..||:|.. :||||||.||||::|...|...||....:     .:.|::.|       
  Fly   613 QPEKMDEYVRENGFAGWFETSAKENINIDEAARALVNKILINDKL-----ISADLADGDKFNLSA 672

Human   190 GGVTG--WKSKC 199
            ...||  .|:||
  Fly   673 ADATGSDAKNKC 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RAB10NP_057215.3 Rab8_Rab10_Rab13_like 7..173 CDD:206659 65/170 (38%)
Switch 1. /evidence=ECO:0000250|UniProtKB:P62820 32..46 4/13 (31%)
Switch 2. /evidence=ECO:0000250|UniProtKB:P62820 64..81 10/16 (63%)
Rab32NP_525109.1 PHA03247 <126..481 CDD:223021
Rab32_Rab38 484..686 CDD:206692 71/206 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.