DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFFR2 and NPFR

DIOPT Version :9

Sequence 1:NP_001138228.1 Gene:NPFFR2 / 10886 HGNCID:4525 Length:423 Species:Homo sapiens
Sequence 2:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster


Alignment Length:378 Identity:108/378 - (28%)
Similarity:185/378 - (48%) Gaps:60/378 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    17 HPIWNVN-DTKHHL------YSDINIT--------YVNYYLHQPQVAA----IFIISYFLIFFLC 62
            ||:..:: .|.|.|      .||:|.|        .::.:|....|.:    :.|..|.::....
  Fly    36 HPLDYLDLGTVHALNTTAINTSDLNETGSRPLDPVLIDRFLSNRAVDSPWYHMLISMYGVLIVFG 100

Human    63 MMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFG--NTMCKISG 125
            .:|||:|...|:|...|.|..|||||||||||||:.:..||:||::.:...||:|  :.:||...
  Fly   101 ALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIA 165

Human   126 LVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEE 190
            ::|.:.:..|..::.|||.||:|.:|||.:..|....|..|:..||.||:.:.||..|       
  Fly   166 MLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFV------- 223

Human   191 KYYRVRLNSQNKT--------SPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMY----- 242
              |:..:|:....        ..:.:|.||||::..|..|:.......||.|:.::.:.|     
  Fly   224 --YKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYN 286

Human   243 ---GRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYAD 304
               .||.:...:|:   :.::..|:    .|:.::...:|:.:|::|.:||||   |...:.|||
  Fly   287 KLKSRITVVAVQAS---SAQRKVER----GRRMKRTNCLLISIAIIFGVSWLP---LNFFNLYAD 341

Human   305 LSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQ 357
            :..:.:....:..|...|.:...::..||::||:.|:|||:.|||.    ||:
  Fly   342 MERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQEL----LCR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFFR2NP_001138228.1 7tm_4 56..>178 CDD:304433 48/123 (39%)
7tm_1 65..336 CDD:278431 84/288 (29%)
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 41/96 (43%)
7tm_1 103..373 CDD:278431 84/288 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.