Sequence 1: | NP_006673.1 | Gene: | FGL2 / 10875 | HGNCID: | 3696 | Length: | 439 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723894.2 | Gene: | CG31832 / 318970 | FlyBaseID: | FBgn0051832 | Length: | 227 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 85/206 - (41%) |
---|---|---|---|
Similarity: | 119/206 - (57%) | Gaps: | 18/206 - (8%) |
- Green bases have known domain annotations that are detailed below.
Human 233 PKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKE 297
Human 298 MILRIDLEDFNGVELYALYDQFYVANEFLKYRL-HVGNYNGTAGDALRFNKHYNHDLKFFTTPDK 361
Human 362 DNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFK 426
Human 427 EAKMMIRPKHF 437 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FGL2 | NP_006673.1 | DUF460 | <28..>161 | CDD:331991 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 103..126 | ||||
FReD | 209..435 | CDD:294064 | 82/202 (41%) | ||
CG31832 | NP_723894.2 | FReD | 28..225 | CDD:238040 | 82/202 (41%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 168 | 1.000 | Inparanoid score | I4150 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.860 |