DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGL2 and CG31832

DIOPT Version :9

Sequence 1:NP_006673.1 Gene:FGL2 / 10875 HGNCID:3696 Length:439 Species:Homo sapiens
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:206 Identity:85/206 - (41%)
Similarity:119/206 - (57%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   233 PKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKE 297
            |:...|:| ...:|....|.|:|.|||||.||.::|..||.|||:...||::|..|::|:|:.:.
  Fly    39 PEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQP 102

Human   298 MILRIDLEDFNGVELYALYDQFYVANEFLKYRL-HVGNYNGTAGDALRFNKHYNHDLKFFTTPDK 361
            ..|.|.|:...|..:||.:|.|.|.:|...|:| .||.|:|||||:||:  |.|   |.|:|.|:
  Fly   103 HELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRY--HIN---KRFSTFDR 162

Human   362 DNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFK 426
            |||. .|.||...:..||||.:|||::|||.|:.:...|:.|||.||.|.          ..|..
  Fly   163 DNDE-SSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGRWK----------FQSLT 216

Human   427 EAKMMIRPKHF 437
            ..::|||||:|
  Fly   217 FVQIMIRPKYF 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGL2NP_006673.1 DUF460 <28..>161 CDD:331991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..126
FReD 209..435 CDD:294064 82/202 (41%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 82/202 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4150
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.