DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN9 and Tsp74F

DIOPT Version :9

Sequence 1:NP_001161792.1 Gene:TSPAN9 / 10867 HGNCID:21640 Length:239 Species:Homo sapiens
Sequence 2:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster


Alignment Length:235 Identity:69/235 - (29%)
Similarity:122/235 - (51%) Gaps:19/235 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     7 CC---LKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVM-VT 67
            ||   :||.:|:.|.:.::.|..:..:.:|..|.: :|..........|.|..|:.:.:|:: :.
  Fly     9 CCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDR-SFVNELLGTNLFSGAVYVLLVTSIIICLV 72

Human    68 GFLGCLGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNV 132
            .||||:||.||.|||||::||::.::.:..||..:|.:|:.::|.:..:::::..:.||.:...:
  Fly    73 SFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREI 137

Human   133 GLKNAWNIIQAEMRCCGVTDYTDW--YPVLGENTVPDRCCMENSQGCGRNAT-----TPLWRTGC 190
              ..||::.|..::||||..:.||  |     ..||:.||.|...|..:..|     |.|:..||
  Fly   138 --TQAWDLTQERLQCCGVDTWHDWNRY-----GPVPESCCQELFGGQRKECTIFPTITNLYNQGC 195

Human   191 YEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHI 230
            ......:..|:..|:|...:.:.|:.|.||.||..||..|
  Fly   196 LYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN9NP_001161792.1 Tetraspannin 9..226 CDD:395265 64/224 (29%)
NET-5_like_LEL 105..202 CDD:239418 26/103 (25%)
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 64/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.