DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN9 and Tsp5D

DIOPT Version :9

Sequence 1:NP_001161792.1 Gene:TSPAN9 / 10867 HGNCID:21640 Length:239 Species:Homo sapiens
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:129/261 - (49%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     8 CLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFLGC 72
            |::......|:|.|||.|..||.|:||.:|...:||..|....|||..:.:.||....|..|.||
  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGC 72

Human    73 LGAIKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVG---- 133
            .||..:::|||:.:|::::::.::|.::..:.|::...:......:|:.|:..::..::.|    
  Fly    73 CGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVA 137

Human   134 --LKNAWNIIQAEMRCCGVTDYTDWYPVL---GENTVPDRCC---------MENSQG-------C 177
              :.:.|:.:|....||||:.|.|||.:.   |...||:.||         :....|       |
  Fly   138 PSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDC 202

Human   178 GRNATTPL-WRTGCYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHI-HR----TGKK 236
            ||:....| |..||...::.||....:|:|.||:.|..:|:.|:..||.||..: |:    |.|.
  Fly   203 GRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTYKS 267

Human   237 Y 237
            |
  Fly   268 Y 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN9NP_001161792.1 Tetraspannin 9..226 CDD:395265 69/242 (29%)
NET-5_like_LEL 105..202 CDD:239418 29/122 (24%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 72/247 (29%)
NET-5_like_LEL 105..228 CDD:239418 29/122 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4711
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4860
Inparanoid 1 1.050 143 1.000 Inparanoid score I4462
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1224210at2759
OrthoFinder 1 1.000 - - FOG0001172
OrthoInspector 1 1.000 - - otm41382
orthoMCL 1 0.900 - - OOG6_108304
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6363
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.