DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A7 and CG33233

DIOPT Version :9

Sequence 1:XP_011512558.1 Gene:SLC22A7 / 10864 HGNCID:10971 Length:610 Species:Homo sapiens
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:306 Identity:71/306 - (23%)
Similarity:123/306 - (40%) Gaps:75/306 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   176 YSPSWRESLGG----LLSGMEWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLV 236
            |..|..||:..    :|:..|:|...::|.|   .:.....|::...:..|:|:||:||:.::.:
  Fly    30 YMYSVTESMTAGYLVVLTSCEFDTSPKEKTL---LANSLLGGMVASGLFIGFLADRYGRKFVIRL 91

Human   237 AYVSTLVLGLASAASVSYVMFAITRTLTGSALA-------GFTIIVMPLGEAE-LEWLDVEHRTV 293
            |.|..|...:.||........::.|.:.|:.|:       ||      |||.. ::|..:   ||
  Fly    92 ALVGALSFSVISALMPDLYSLSVIRIIVGTFLSAVASLQVGF------LGEFHAIKWRPI---TV 147

Human   294 A------------------GVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWV 340
            |                  .:|.:.|   .|.|.:  .|.:|.||:|::...:|....::.:..|
  Fly   148 AICSQSQGLALIYCPLVAMAILPNNF---NVDLSS--SYNLRVWRFLMMFFMIPGWLALVGICLV 207

Human   341 PESARWLLTQGHVKEAHRYLLHCARLNGRPVCED-----------SFSQEAVSKVAAGERVVRRP 394
            ||:..:|::.....:|...|....|:| |...||           :..||...|....|      
  Fly   208 PETPHFLMSVNRPDKALLALKWICRMN-RKKWEDVDITLSEEKSSTNDQEGFWKTVWYE------ 265

Human   395 SYLDLFRTPRLRHISLCCVVVWFGVNFSYYGL--------SLDVSG 432
             |..||..|.:....:|..:: ||:.|:..||        ::|.||
  Fly   266 -YKLLFSKPHVFKFFICLFLI-FGIFFTSIGLGIWFPVIRNMDNSG 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A7XP_011512558.1 2A0119 11..585 CDD:273328 71/306 (23%)
MFS 206..563 CDD:119392 62/272 (23%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 71/306 (23%)
MFS 23..>208 CDD:119392 43/194 (22%)
MFS 354..>482 CDD:304372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.