DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP46A1 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:536 Identity:141/536 - (26%)
Similarity:234/536 - (43%) Gaps:83/536 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     5 LLLLGSAVLLAFGLCCTFVHRARSR----YEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFL 65
            :.||||.::.     ....::.|||    .|.||||....||...:......||:..||     :
  Fly    31 VFLLGSILIF-----LVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRV-----I 85

Human    66 DWAKKYGPVVRVN-VFHKTS--VIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVS 127
            ...|.:|..:.:| |:..|:  |::..||:|:..|.|.|:...|..|..|....||     ||::
  Fly    86 GMQKLWGTRIGINRVWQGTAPRVLLFEPETVEPILNSQKFVNKSHDYDYLHPWLGE-----GLLT 145

Human   128 ECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDIL 192
            ..: .:||.:|:::..||....|...::.|||::..|...|..:. |....::...:|...:||:
  Fly   146 STD-RKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLARKLAVEV-GSEAFNLFPYVTLCTLDIV 208

Human   193 AKAAFGMETSMLLGAQKPLSQAV------------KLMLE-----GITASR-------NTLAKFL 233
            .:.|.|........::....:||            |:.|:     .:||..       |||..| 
  Fly   209 CETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGF- 272

Human   234 PGKRKQLREVRESIRFLRQ---------------VGRDWVQRRREALKRGEEVPADILTQILKAE 283
              ....:||.:..:..|::               ||:    ::|.|.       .|:|....| |
  Fly   273 --SNMVIRERKAELAILQENNNNNNNNAPDAYDDVGK----KKRLAF-------LDLLIDASK-E 323

Human   284 EGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRY--LDFED 346
            .....:|.:.:...||...||:|::..:::|:..|...||...|:..|:|.:.|..:.  ...::
  Fly   324 GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKN 388

Human   347 LGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTF 411
            |..::||...:|:||||:|......|::.|:..|.|..||..|..:..||.:.|....|..|..|
  Fly   389 LMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIVPAGTQAIIMTYALHRNPRVFPKPEQF 453

Human   412 NPDRFGPG--APKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQR-FGLQEQ 473
            |||.|.|.  |.:..|.|.|||.|.|:||||:||.:|.|.|::.:|::.:...|..:. ..|..:
  Fly   454 NPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGE 518

Human   474 ATLKPLDPVLCTLRPR 489
            ..|:|.|.:...:.||
  Fly   519 LILRPKDGLRVKITPR 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP46A1NP_006659.1 p450 34..466 CDD:365848 126/477 (26%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 130/498 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.