DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP46A1 and Cyp313a3

DIOPT Version :9

Sequence 1:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens
Sequence 2:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster


Alignment Length:482 Identity:116/482 - (24%)
Similarity:214/482 - (44%) Gaps:67/482 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    12 VLLAFGLC--CTFVHRARSRYE---HIPGP---PRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWA 68
            :|||.|:|  ..|:...|..|.   .||||   |.......:|..:.:|..:..:.: |:     
  Fly     6 LLLAVGVCFWIYFLWSRRRLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYM-DI----- 64

Human    69 KKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTK-YNKDSKMYRALQTVFGERLFGQGLVSECNYE 132
              ||....|.|.....||...|:..::..:|.: .|:.|...:.:.:..|:     ||:| ....
  Fly    65 --YGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFSKPVNSCTGD-----GLLS-LEAS 121

Human   133 RWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDML----------TYT 187
            :|..:|:.::.||.::.|:|.:..||.:|:.||..|::.. ||....::|.:          |..
  Fly   122 KWVDRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLV-GQGEKKVRDDIVRWSFRIATQTTV 185

Human   188 AMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITA--SRNTLAKFLPGKRKQLREVRESIRFL 250
            ..|:...|:|..::.:     |.....:|:::..:..  :.|.:...|.|...|....:.::.  
  Fly   186 GTDVKKDASFKNDSVL-----KSYETFMKIIVMNVLLPFTHNKIFSTLGGFETQKALAKSNVN-- 243

Human   251 RQVGRDWVQRRREALKRGEEVPADILTQILKAEE----GAQDDEGLLDNFVTFFIAGHETSANHL 311
            :.:|.  :..::...|.......:|.:.|.||.|    |....|.:.....:|.:|..||:.:.:
  Fly   244 KMIGT--IVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSREEVQSECCSFVVAAFETTGDTV 306

Human   312 AFTVMELSRQPEIVARLQAEVDEV--IGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLL 374
            ...::.|:..||....:..|:.|:  :.....:.::||.|:.:|.:|:.|:|||.|....|.|  
  Fly   307 YHALILLAMFPEHQDTVYQELKELFPVAGDFEVTYDDLQRMVFLERVVNETLRLIPSVPFTPR-- 369

Human   375 EEETLID-----GVRVPGNTPL---LFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPR--FTYFP 429
              ||:.|     ||.:|....:   :|:|:  ...|.:..||.:||||.|.|...:.|  :.|.|
  Fly   370 --ETIRDFRLSSGVVIPKGVGIGIDIFATH--RNRDHWGTDPSSFNPDHFLPDNVRDRHPYAYIP 430

Human   430 FSLGHRSCIGQQFAQMEVKVVMAKLLQ 456
            ||.|.|:|||.::..|..|:.::|:|:
  Fly   431 FSKGRRNCIGWKYGLMSSKLALSKILR 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP46A1NP_006659.1 p450 34..466 CDD:365848 107/455 (24%)
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 107/455 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.