DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP46A1 and Cyp313a5

DIOPT Version :9

Sequence 1:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens
Sequence 2:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster


Alignment Length:511 Identity:120/511 - (23%)
Similarity:219/511 - (42%) Gaps:71/511 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     7 LLGSAVLLAFG--LCCTFVHRARSRY---EHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLD 66
            :|...:..||.  ||..|:...|..|   ..:|||....|:.........|.::..|.:  :|  
  Fly     1 MLTLQIFEAFAIILCVYFLWSRRRFYIMMLKLPGPMGFPFIGLAFEYIRLKRKIRLRTI--LF-- 61

Human    67 WAKKYGPVVRVNVFHKTSVIVT-SPESVKKFLMSTK-YNKDSKMYRALQTVFGERLFGQGLVSEC 129
              |.||..| :.....|.|:|| .|:.::....|.. .|:.|.:.:|:.:     ..|.||::..
  Fly    62 --KIYGKTV-LTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKAISS-----CLGLGLLTLK 118

Human   130 NYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAK 194
            | ..|:::|:::..:|..::::|.:...|.:|..||.:|....|| ..:::...|...:..|.|:
  Fly   119 N-NHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDG-GDINLLPELNKWSFKIAAQ 181

Human   195 AAFGME--------TSMLLGAQKPLSQAVKLMLEGITAS--RNT-LAKFLPGKRKQLREVRESIR 248
            ...|.|        ...||.:.|.|:..:.:   |:...  ||. |.|....::::|....:|..
  Fly   182 ITMGDEVRNQANYQNGNLLESYKALNNLIPI---GVVMPWLRNKYLGKLFSYEKRRLEAATQSNA 243

Human   249 FLRQVGRDWVQRRREALKRGEEVPA--DILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHL 311
            |:    :|.:.::..:.....| ||  |.:..:::..|.:.||  ::..|.....|..:|.:..:
  Fly   244 FI----KDIIDKKLSSTDNSSE-PALIDRILNLVRIGELSYDD--VMGEFSNIIFAASDTLSITV 301

Human   312 AFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFE----DLGRLQYLSQVLKESLRLYPPAWGTFR 372
            ...::.::..|:....:..|:.||..|..  :||    ||.:|..|.:||.|::||.|    ...
  Fly   302 NNVLILMAMFPKYQDNVFEELAEVFPSGG--EFEASHADLEKLVKLDRVLHETMRLIP----AVP 360

Human   373 LLEEET-----LIDGVRVPGNTPLLFSTYVMGR-MDTYFEDPLTFNPDRFGP--GAPKPRFTYFP 429
            ||..:|     |.:|..:|....|:...:...| .|.:......||||.|.|  ...:|.::|.|
  Fly   361 LLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRARPPYSYLP 425

Human   430 FSLGHRSCIGQQFAQMEVKVVMAKLLQRL---------EFRLVPGQRFGLQEQATL 476
            ||.|.::|:|.:.:.:..|:.:||:|:..         :.|.:......|.||..|
  Fly   426 FSKGKKTCLGWKLSLISAKLALAKILRNYMLSTTFLYKDLRFIDNTTMKLAEQPLL 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP46A1NP_006659.1 p450 34..466 CDD:365848 108/467 (23%)
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 107/454 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825914at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.