DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP46A1 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:519 Identity:120/519 - (23%)
Similarity:212/519 - (40%) Gaps:89/519 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    10 SAVLLAFGLCCTF----VHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFL----- 65
            :|..:.|.|...|    ..|.||..:::.|           |..|   .:.|.:.:.:||     
  Fly     4 TATFICFCLASAFNYFRARRQRSLIKNLKG-----------PFTW---PLMGAMHKLLFLTPINF 54

Human    66 -----DWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGL 125
                 ::..|||...|..|||:..:.:...|..::.|.:..:         |:|  |..|....|
  Fly    55 FQRSTEYLTKYGTFSRCWVFHRLFIPLADLELSRQLLENDTH---------LET--GYELMKDWL 108

Human   126 VS---ECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYT 187
            |.   .|..|:|.|:..:|...|.:.:|..|::....:.|||::.|..:|| |....:...::..
  Fly   109 VGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQAD-QKVFDIWYTVSPI 172

Human   188 AMDILAKAAFGMETSMLLGAQ-KPLSQAV-KLMLEGITASR--------------NTLAKFLPGK 236
            .:|::.....|.:.|...... |.||:.. |..|...:|:|              |.|.|.|..:
  Fly   173 VLDLMVMTTCGAKPSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNRLIKRLNDE 237

Human   237 RKQLREVRESIRFLR-QVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF 300
            ...|..:.:|...|: :.|.|..|.|...||..:    .:|..:|::::.....|.:.....|..
  Fly   238 HNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHK----SLLEILLESKDPQLTGEEICGELNTCN 298

Human   301 IAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYP 365
            ..|::..:..|.|.::.::|.|.:   .|..:||:..::......||.:|.||..||.|::||||
  Fly   299 YLGYQLCSPALCFCLVTIARNPSV---QQKCLDELNLAQIKDQGWDLEKLNYLDAVLHETMRLYP 360

Human   366 PAWGTFRLLEEE-----TLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRF 425
            |.....|.|:::     :::....:|..:.:..:.|.:.|.:..:.....|:..||....|:   
  Fly   361 PQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYELQRNEVRYPKANHFDAQRFLDSPPE--- 422

Human   426 TYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQ-----------RLEFRLVPGQRFGLQEQATLKP 478
             ...:|||.|.|..::|:...:|.::|.:|.           ||:.|||.|...|.  |..|||
  Fly   423 -LLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYGDEVRLDLRLVLGSSNGF--QLALKP 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP46A1NP_006659.1 p450 34..466 CDD:365848 107/477 (22%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 103/469 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.