DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP46A1 and Cyp4d2

DIOPT Version :9

Sequence 1:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens
Sequence 2:NP_001284806.1 Gene:Cyp4d2 / 31192 FlyBaseID:FBgn0011576 Length:501 Species:Drosophila melanogaster


Alignment Length:520 Identity:158/520 - (30%)
Similarity:256/520 - (49%) Gaps:60/520 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     7 LLGSAVLLAFG--LCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAK 69
            ::|..:|:||.  |...|:.|.|.. ..:|| |||...||:|..:...|       .:..:|:.|
  Fly     4 VVGVLLLVAFATLLLWDFLWRRRGN-GILPG-PRPLPFLGNLLMYRGLD-------PEQIMDFVK 59

Human    70 ----KYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECN 130
                |||.:.||.:.|:.:|..|.|..::..|.|.::...:.:|:.|....|:     ||:....
  Fly    60 KNQRKYGRLYRVWILHQLAVFSTDPRDIEFVLSSQQHITKNNLYKLLNCWLGD-----GLLMSTG 119

Human   131 YERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKA 195
             .:||.:|::|...|....|...:|.|::::..:||.|:::|||.||:::..::..||:||:|:.
  Fly   120 -RKWHGRRKIITPTFHFKILEQFVEIFDQQSAVMVEQLQSRADGMTPINIFPVICLTALDIIAET 183

Human   196 AFGMETSMLLGAQK----PLSQAVK-----LMLEGITASRNTLAKFLPGKRKQLREVRESIRFLR 251
            |.|.:    :.|||    |..|||.     |:...|.|.:.....|...:..:.:...::|:.:.
  Fly   184 AMGTK----INAQKNPNLPYVQAVNDVTNILIKRFIHAWQRVDWIFRLTQPTEAKRQDKAIKVMH 244

Human   252 QVGRDWVQRRREALKRG-------EEVP----------ADILTQILKAEEGAQ-DDEGLLDNFVT 298
            ....:.::.|||.|...       |||.          .|:|.|  ...:||. .||.:.:...|
  Fly   245 DFTENIIRERRETLVNNSKETTPEEEVNFLGQKRRMALLDVLLQ--STIDGAPLSDEDIREEVDT 307

Human   299 FFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRY--LDFEDLGRLQYLSQVLKESL 361
            |...||:|:.:.::|.:.|:||.||:..|||.|:.:|:|..|.  :...|||.|:::..|:||||
  Fly   308 FMFEGHDTTTSAISFCLYEISRHPEVQQRLQQEIRDVLGEDRKSPVTLRDLGELKFMENVIKESL 372

Human   362 RLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPR-F 425
            ||:||.....|...|:..|.|..:|..|......:|:.|...|||.|..|.|:||....|:.. :
  Fly   373 RLHPPVPMIGRWFAEDVEIRGKHIPAGTNFTMGIFVLLRDPEYFESPDEFRPERFDADVPQIHPY 437

Human   426 TYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLE-FRLVPGQRFGLQEQATLKPLDPVLCTLRPR 489
            .|.|||.|.|:||||:||.:|:|..::|||:..| ..|.|..|..:  ...|:..:.|...|:||
  Fly   438 AYIPFSAGPRNCIGQKFAMLEMKSTVSKLLRHFELLPLGPEPRHSM--NIVLRSANGVHLGLKPR 500

Human   490  489
              Fly   501  500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP46A1NP_006659.1 p450 34..466 CDD:365848 144/466 (31%)
Cyp4d2NP_001284806.1 p450 32..495 CDD:278495 147/484 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.