DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP46A1 and Cyp4g1

DIOPT Version :9

Sequence 1:NP_006659.1 Gene:CYP46A1 / 10858 HGNCID:2641 Length:500 Species:Homo sapiens
Sequence 2:NP_525031.1 Gene:Cyp4g1 / 30986 FlyBaseID:FBgn0010019 Length:556 Species:Drosophila melanogaster


Alignment Length:516 Identity:121/516 - (23%)
Similarity:226/516 - (43%) Gaps:85/516 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     2 SPGL-LLLGSAVLLAFGLCCTFVHRARSRYEH-----IPGPPRPSFLLGHLPCFWKKDEVGGRVL 60
            ||.| .|:|:.|.:|.     :.:..|:..|:     ||.||       .||...:.....|...
  Fly    25 SPMLTTLVGTLVAMAL-----YEYWRRNSREYRMVANIPSPP-------ELPILGQAHVAAGLSN 77

Human    61 QDVF---LDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFG 122
            .::.   |.:..|||..::..:.:...|.:|:|..::..|...::...::.||..:..||:.|  
  Fly    78 AEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGL-- 140

Human   123 QGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYT 187
              |:|  |...|...|::|...|.:|.|.|.:.||.:.::.:|..:..:| |:: ..:.|.::.|
  Fly   141 --LIS--NGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEA-GKS-FDVHDYMSQT 199

Human   188 AMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASR-------NTLAKFLPGKRKQLREVRE 245
            .:|||...|.|::...........:|||..|.:.|...:       :::.||...:.|..|.:..
  Fly   200 TVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNI 264

Human   246 SIRFLRQVGRDWVQRRREALKRG-----EEVPADILTQILKAEEGAQDD---------------- 289
            .:....:|.:|    |:|..:..     ||:...:.:.....:||.:||                
  Fly   265 ILGMTSKVVKD----RKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLA 325

Human   290 ------------------EGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVI 336
                              :.::|...|....||:|::...:|.:..:....:|.|::.||...:.
  Fly   326 LLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIF 390

Human   337 GSKRYLD--FEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEE-TLIDG-VRVPGNTPLLFSTYV 397
            |.....|  |.|...::||.:|:.|:||||||.....|.|:.: .|..| ..||..|.::...|.
  Fly   391 GDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYC 455

Human   398 MGRMDTYFEDPLTFNPDRFGPG--APKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQ 456
            :.|....:.:|..|:||.|.|.  |.:..:::.|||.|.|||:|:::|.:::||:::.:::
  Fly   456 VHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVR 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP46A1NP_006659.1 p450 34..466 CDD:365848 111/478 (23%)
Cyp4g1NP_525031.1 p450 58..518 CDD:278495 111/478 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.