DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT3 and CG15418

DIOPT Version :9

Sequence 1:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens
Sequence 2:NP_001334671.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster


Alignment Length:85 Identity:30/85 - (35%)
Similarity:43/85 - (50%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     4 QASLSFLLILTLCLELRS--ELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAY 66
            |..|..||::.|.|.|.|  ....:.|:.::  .|..|...|.|:.:..|:.:|.:||.||.|.|
  Fly     9 QLWLVLLLVVGLSLGLPSLENQTHEQIEQII--ACRQPKAPGLCRGHQLRYAYNKKTGNCESFIY 71

Human    67 GGCGGNSNNFLRKEKCEKFC 86
            .||....||||..|:|.:.|
  Fly    72 TGCASTENNFLTFEECRRDC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT3NP_006643.1 KU 34..87 CDD:238057 21/53 (40%)
CG15418NP_001334671.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6653
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.