DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT3 and tag-290

DIOPT Version :9

Sequence 1:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens
Sequence 2:NP_505945.1 Gene:tag-290 / 179593 WormBaseID:WBGene00009386 Length:219 Species:Caenorhabditis elegans


Alignment Length:55 Identity:19/55 - (34%)
Similarity:25/55 - (45%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    36 CAFPMEKG-PCQTYMTRWFFNFET--GECELFAYGGCGGNSNNFLRKEKCEKFCK 87
            |..|.:.| .|........|.|:|  ..|:.|.|.|||||.|.|...::|...|:
 Worm    19 CTQPKDSGNVCSGSQAERSFYFDTRMKVCQPFLYSGCGGNENRFSTSKECRDACQ 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT3NP_006643.1 KU 34..87 CDD:238057 18/53 (34%)
tag-290NP_505945.1 Kunitz_BPTI 19..73 CDD:278443 18/53 (34%)
KU 156..211 CDD:197529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.