powered by:
Protein Alignment SPINT3 and tag-290
DIOPT Version :9
Sequence 1: | NP_006643.1 |
Gene: | SPINT3 / 10816 |
HGNCID: | 11248 |
Length: | 89 |
Species: | Homo sapiens |
Sequence 2: | NP_505945.1 |
Gene: | tag-290 / 179593 |
WormBaseID: | WBGene00009386 |
Length: | 219 |
Species: | Caenorhabditis elegans |
Alignment Length: | 55 |
Identity: | 19/55 - (34%) |
Similarity: | 25/55 - (45%) |
Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
Human 36 CAFPMEKG-PCQTYMTRWFFNFET--GECELFAYGGCGGNSNNFLRKEKCEKFCK 87
|..|.:.| .|........|.|:| ..|:.|.|.|||||.|.|...::|...|:
Worm 19 CTQPKDSGNVCSGSQAERSFYFDTRMKVCQPFLYSGCGGNENRFSTSKECRDACQ 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SPINT3 | NP_006643.1 |
KU |
34..87 |
CDD:238057 |
18/53 (34%) |
tag-290 | NP_505945.1 |
Kunitz_BPTI |
19..73 |
CDD:278443 |
18/53 (34%) |
KU |
156..211 |
CDD:197529 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.770 |
|
Return to query results.
Submit another query.