DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPH1 and CG7182

DIOPT Version :9

Sequence 1:NP_001273433.1 Gene:HSPH1 / 10808 HGNCID:16969 Length:860 Species:Homo sapiens
Sequence 2:NP_001286979.1 Gene:CG7182 / 38944 FlyBaseID:FBgn0035878 Length:513 Species:Drosophila melanogaster


Alignment Length:529 Identity:118/529 - (22%)
Similarity:208/529 - (39%) Gaps:108/529 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    44 GSKNRTIGVAAKNQQITHANNTVSNFKRFHGRAFNDPFIQKEKENLSYDL--VPLKNGGVGIKVM 106
            |:.....|:.||.:........|:     |......|..:..:|.||..|  :|..         
  Fly    45 GASEIECGLTAKQKMANRPRQAVA-----HSFQLLQPKEELTEEKLSSALREIPCD--------- 95

Human   107 YMGEEHLFSVE----------------------QITAMLLTKLKETAE----NSLKKPVTDCVIS 145
            :..||.:|.:|                      |:|..||....|.|.    :..:.|:  .|:|
  Fly    96 FDKEELVFRMEHTVPSDREDQDDRVVTKDLSAYQVTVELLRAELELAHQYHTDGEQAPI--AVLS 158

Human   146 VPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALNYGIYKQDLPSLDEKPRIVVFVDMGHSAF 210
            :||::..:..:.:.||||..|.:..:::.:.||..|.|.|.::.    .|:.|.|:.:..|....
  Fly   159 IPSYYPASAYKLLADAAQTAGFHVAQIITEPTAAVLGYSIGEEQ----TEQRRHVLTIKCGGLYS 219

Human   211 QVSACAFNKGKLKVLGTAFDPF-LGGKNFDEKLVEHFCAEFKTKYKLDAKSKIRALLRLYQECEK 274
            .::..:...|....|.| |.|| :||:.|.|.||:..|.||:.|||||.....|::.::......
  Fly   220 DIAFYSVQNGLFVQLAT-FGPFPIGGRQFTEALVQFICEEFRRKYKLDPHESRRSVAKIRTAAAN 283

Human   275 LKKLMSSNSTDLP---LNIECFMNDKDVSGKMNRSQFEELCAELLQKIEVPLYSLLEQT---HLK 333
            .|.::    |.:|   |.|:..|:..|.:.:|:|::||.|...::..:...|...:||.   |..
  Fly   284 CKHIL----TTMPSTQLYIDSLMDGVDYNAQMSRARFESLIQPVINNLIQQLGECVEQAQKEHPG 344

Human   334 VEDVSAVEIVGGATRIPAVKERI-AKFFGKDISTTLNADEAVARGCALQCAILSPAFKVREFSVT 397
            :..:..:.::|...:||.::..: |:|....:..:.:|||.||.|||.|...|....:.:.....
  Fly   345 LSKIDDIVLLGATMQIPKLQAAVGARFPDAKLHNSHSADEVVAIGCARQAVCLIDPLEQQLHKEE 409

Human   398 DAVPFPISL-IWNHDSEDTEGVHEVFSRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKI 461
            |.|.....| ||:.:.|....:  |..|....| :|:                   .:..|:::.
  Fly   410 DCVVAEDDLFIWHGNDESNAKL--VLGRGSVLP-AKI-------------------RISLPQSEE 452

Human   462 GRFVVQNVSAQKDGEKSRVKVKVRVNTHGIFTISTASMVEKVPTEEN--EMSSEADMECLNQRPP 524
            |:        ..|..|:....|:|.....|.    |.:.:....|:.  ::..|.|::       
  Fly   453 GK--------GDDVSKAAASFKLRTGESEIL----ARLPDSTIPEDGLYQLEVEVDVD------- 498

Human   525 ENPDTDKNV 533
               |.|.||
  Fly   499 ---DKDGNV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPH1NP_001273433.1 NBD_sugar-kinase_HSP70_actin 39..386 CDD:327376 92/377 (24%)
CG7182NP_001286979.1 NBD_sugar-kinase_HSP70_actin 5..394 CDD:302596 91/373 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.