DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY2 and Gycalpha99B

DIOPT Version :9

Sequence 1:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:235 Identity:69/235 - (29%)
Similarity:114/235 - (48%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   236 EKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT 300
            |:::...||..:.||.||.::...                   .::..|.:.:|:||::||||||
  Fly   431 ERKKNVSLLHLIFPAEIAEKLWLG-------------------SSIDAKTYPDVTILFSDIVGFT 476

Human   301 RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDM 365
            .:.|..:|..::.||..|:..||:.....:..:::.:||.|...|||..:....|.....|.|.|
  Fly   477 SICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKM 541

Human   366 CEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSV 430
            .:|..|.....|..|.||:|:|:|.||.||:|.:..:|.::.|.||:||..|:|....::::|..
  Fly   542 IDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVSPT 606

Human   431 TLEHLNGAYKVEEGDGDI--RDPYLKQHLVKTYFVINPKG 468
            |.:.|.   |.|..:.::  |||   ..|.|.:  .||.|
  Fly   607 TKDWLT---KHEGFEFELQPRDP---SFLPKEF--PNPGG 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 7/23 (30%)
CYCc 236..439 CDD:214485 59/202 (29%)
Guanylate_cyc 281..465 CDD:278633 59/185 (32%)
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485
Guanylate_cyc 878..1077 CDD:278633
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 7/19 (37%)
CYCc 430..619 CDD:214485 61/209 (29%)
Guanylate_cyc 457..647 CDD:278633 62/190 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.