DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY2 and Gyc89Da

DIOPT Version :9

Sequence 1:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:324 Identity:91/324 - (28%)
Similarity:162/324 - (50%) Gaps:50/324 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   772 GYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFIT-------LLVLGRQNEYYC- 828
            |..:|||......:.|...::|....:.::|..:..:.|.:..:.       |::.|.|   :| 
  Fly   369 GLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQ---HCS 430

Human   829 RLDFLWKNKFKKEREEIETMENLNRV----------LLENVLPAHVAEHFLARSLKNEELYHQSY 883
            :|:.:    |:||.:..:.:|....:          ||.:::|..:||    |...:||...||:
  Fly   431 KLEIM----FEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAE----RMRLSEEQVCQSF 487

Human   884 DCVCVMFASIPDFKEFYTESDVNKEG-LECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMA 947
            :.|.|:|..:   ...|.|...:.:| ::.:..||::.:..|:.:..|   .|.|::|:|..|||
  Fly   488 EEVSVIFLEV---MNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIISP---FVYKVETVGMVYMA 546

Human   948 ATGLSAVPSQEHSQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIG 1012
            .:|           .|:...:|.....:.|..::.|..|   |...|..:|||||.|||:|||:|
  Fly   547 VSG-----------APDVNPLHAEHACDLALRVMKKFKA---HDMGDVAIRVGINSGPVVAGVVG 597

Human  1013 AQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFV 1076
            .:.|:|.::|:|||.||||:|:....|||:::.|...::.:||....||.:.||||||::||::
  Fly   598 QKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETYWL 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831
CYCc 236..439 CDD:214485
Guanylate_cyc 281..465 CDD:278633
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485 64/218 (29%)
Guanylate_cyc 878..1077 CDD:278633 66/200 (33%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922 3/17 (18%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993 1/2 (50%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 22/117 (19%)
CYCc 457..643 CDD:214485 64/209 (31%)
Guanylate_cyc 485..662 CDD:278633 66/197 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.