DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY2 and CG14877

DIOPT Version :9

Sequence 1:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:148 Identity:26/148 - (17%)
Similarity:53/148 - (35%) Gaps:44/148 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   857 ENVLPAHVAEHFLARSLK----------NEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLE 911
            ::::|:|:...:||...|          .:.:..|   |..|:|..:.|:.              
  Fly    75 KSLIPSHIDFEWLAHDTKCDASLGVIKAMDGIIKQ---CAQVIFGPVCDYS-------------- 122

Human   912 CLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGT-MVE 975
             |..::.|...|:.       .|...|...||||..        .|:.:...:..||.:.| |:.
  Fly   123 -LAAVSRITKYFNS-------QGTPLISVGGSTYDF--------EQKKTDCNDEFYMLLRTGMLS 171

Human   976 FAFALVGKLDAINKHSFN 993
            |.......::.:.:|:::
  Fly   172 FETISELTINVMKRHNWS 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831
CYCc 236..439 CDD:214485
Guanylate_cyc 281..465 CDD:278633
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485 26/148 (18%)
Guanylate_cyc 878..1077 CDD:278633 21/117 (18%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922 2/16 (13%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993 1/2 (50%)
CG14877NP_650507.1 Periplasmic_Binding_Protein_Type_1 46..>241 CDD:299141 26/148 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.