DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY2 and Gyc88E

DIOPT Version :9

Sequence 1:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:148/276 - (53%) Gaps:25/276 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   203 LAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGP 267
            |||......::|||.|..|.:....:|...|:.|.|:.:.||..::|..:     |:.::|.:.|
  Fly   351 LAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQV-----ADRLRRGENP 410

Human   268 KAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECM 332
                ::....|        .:||||::|||.||.:.|..:|.|:|.|||.::..||::.:.|...
  Fly   411 ----IDTCEMF--------DSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVY 463

Human   333 RIKILGDCYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRD-ATGVDINMRVGVHSGNVLCGVI 396
            :::.:||.|..|:|.|....|||:....|.|||.:||..::| :||..:.:|||||||.|:.|::
  Fly   464 KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIV 528

Human   397 GLQKWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYK-VEEGDGDIRDPYLKQHLVKT 460
            ||:..:|.::...|..|:.||:..:..:||||..|...:...|| :|.|:.|::.    :..:.|
  Fly   529 GLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKG----KGTMGT 589

Human   461 YFVINPKGERRSPQHL 476
            |::  .:.|.|.|..|
  Fly   590 YWL--EERENRLPLQL 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831 16/56 (29%)
CYCc 236..439 CDD:214485 67/203 (33%)
Guanylate_cyc 281..465 CDD:278633 65/185 (35%)
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485
Guanylate_cyc 878..1077 CDD:278633
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 16/57 (28%)
CYCc 383..571 CDD:214485 67/204 (33%)
Herpes_ICP4_C 794..>955 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.