DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY2 and CG42637

DIOPT Version :9

Sequence 1:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens
Sequence 2:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster


Alignment Length:279 Identity:85/279 - (30%)
Similarity:130/279 - (46%) Gaps:61/279 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   835 KNKFKKER---------EEIETME----NLNRV-----------------LLENVLPAHVAEHFL 869
            :|:.||.|         :.:|.||    ||..:                 ||..:||..|||   
  Fly   818 RNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAE--- 879

Human   870 ARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSG 934
             :....:.:...|||.|.:.|:.|..|.....||    ..|:.:..||::...||.::   :...
  Fly   880 -KLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAES----TPLQVVNFLNDLYTVFDRII---RGYD 936

Human   935 VEKIKTIGSTYMAATGLSAVPSQEHSQEPERQYMHIGTMVEFAFALVGKLDAINKHSF-----ND 994
            |.|::|||..||..:||.......|:          |.:...|..|   |.|:.:|..     ..
  Fly   937 VYKVETIGDAYMVVSGLPIKNGDRHA----------GEIASMALEL---LHAVKQHRIAHRPNET 988

Human   995 FKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTL--GYTC 1057
            .|||:|::.|||:|||:|...|:|.::|:|||.||||:|.|...||.::.:..|.|..|  ||..
  Fly   989 LKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYIT 1053

Human  1058 TCRGIINVKGKGDLKTYFV 1076
            ..||::|:|||||:.|:::
  Fly  1054 EKRGLVNMKGKGDVVTWWL 1072

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY2NP_065433.2 AC_N <33..260 CDD:292831
CYCc 236..439 CDD:214485
Guanylate_cyc 281..465 CDD:278633
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485 70/235 (30%)
Guanylate_cyc 878..1077 CDD:278633 69/206 (33%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922 3/16 (19%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993 1/7 (14%)
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 4/8 (50%)
HNOBA <835..881 CDD:285003 12/49 (24%)
CYCc 860..1052 CDD:214485 66/215 (31%)
Guanylate_cyc 887..1074 CDD:278633 69/206 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.