DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEK6 and Nek2

DIOPT Version :9

Sequence 1:NP_001138473.1 Gene:NEK6 / 10783 HGNCID:7749 Length:347 Species:Homo sapiens
Sequence 2:NP_572415.1 Gene:Nek2 / 31696 FlyBaseID:FBgn0029970 Length:735 Species:Drosophila melanogaster


Alignment Length:265 Identity:100/265 - (37%)
Similarity:154/265 - (58%) Gaps:16/265 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    75 SLADFQIEKKIGRGQFSEVYKATCLLDRKT---VALKKVQIFEMMDAKARQDCVKEIGLLKQLNH 136
            :|.|:::...:|.|.|...||   :.|:.|   .|.|.:...|:.:||. ...|.||.:|:||.|
  Fly    15 TLQDYEVLAVMGNGSFGTCYK---VRDKSTGELFAWKGMNYDELDEAKC-DALVSEISVLRQLQH 75

Human   137 PNIIKYLDSFI--EDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHS 199
            |||::|....:  |...:.||:|....|||:|:::..:.|::...|..:|:...|||.|::..|:
  Fly    76 PNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHN 140

Human   200 R----RVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNF 260
            :    .::||||||||:|:.|.|..||||.||.|....:.:.|.|.||||:|||||.:....|:.
  Fly   141 KIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDR 205

Human   261 KSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPH 325
            |||:|::|||:|||.||:.||.|...:  .|.:||.|.::..:|. .||..|:|:::..:..|..
  Fly   206 KSDVWAVGCLVYEMCALRPPFRGRAFD--QLSEKIAQGEFSRIPA-IYSTDLQEIIAFMLAVDHE 267

Human   326 QRPDI 330
            |||.|
  Fly   268 QRPGI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEK6NP_001138473.1 STKc_Nek6 76..343 CDD:270865 100/264 (38%)
S_TKc 79..344 CDD:214567 98/261 (38%)
Nek2NP_572415.1 STKc_Nek2 18..281 CDD:270857 99/262 (38%)
S_TKc 19..281 CDD:214567 98/261 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.