DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZBTB6 and CG6654

DIOPT Version :9

Sequence 1:NP_006617.1 Gene:ZBTB6 / 10773 HGNCID:16764 Length:424 Species:Homo sapiens
Sequence 2:NP_650429.1 Gene:CG6654 / 41831 FlyBaseID:FBgn0038301 Length:639 Species:Drosophila melanogaster


Alignment Length:395 Identity:87/395 - (22%)
Similarity:144/395 - (36%) Gaps:124/395 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   116 VEKCTEALSKYLEIDLSMKNN-----NQHTDLCQSSDPDVKNE--------DENSDKDCEIIEIS 167
            |||.|   |..|::..::|:.     .|...:.:..|.:::.:        .|..|.:.|||.::
  Fly   162 VEKTT---SLILQVQGNLKDEKEVVFTQTNVIYEGDDHELEQQIRECNLAIFEGVDNEAEIITVT 223

Human   168 ---------------------EDSPVNIDFHVKEEESNALQSTVESLTSERKEMKSPEL-----S 206
                                 ..:||......:|.|...:..:.:. ||.|:.:...::     |
  Fly   224 APQVTTRKSAAKLLTQQENDKHQTPVGSKEEARELEKEQVPQSAKR-TSRRRGVVKQDVPATPPS 287

Human   207 TVDIGFKDNEICILHVESISTAGVENGQFSQPCTSSKA---------------------SMYFSE 250
            ..:...|.:.:......|...||..||    |.|:|.|                     |:....
  Fly   288 DAEPSPKQHRLGTQRKLSAPRAGTVNG----PSTTSGAATTPELKYHCDRCNAGFAVEKSLMIHR 348

Human   251 TQHSLINSTVE-----------SRVAEVPGNQ------DQGLFCENTEGSYGTVSEIQNLEEGY- 297
            .|...||...:           ..:||...:.      :.|:.|::.|      :..:::.:|: 
  Fly   349 RQKGCINRNYKCNECEKVFVSPDHLAEHQASHGAHNCPECGIRCDSKE------ALSKHMVQGHK 407

Human   298 -SLRHQCPRCPRGFLHVENYLRHLKMH---KLFLCLQCGKTFTQKKNLNR--------------- 343
             :||:||..|.:.|..:.....|:::|   |.|:|..|||:|||..||.:               
  Fly   408 RNLRNQCNICQKVFTMLSTLRDHMRIHTGEKPFVCNICGKSFTQNANLRQHKLRHSETKSFKCEL 472

Human   344 -------------HIRGHMGIRPFQCTVCLKTFTAKSTLQDHLNIHSGDRPYKCHCCDMDFKHKS 395
                         |.|.|.|.:||:|.|||..||...:|..|...|:|:|||.|..|.|.|...:
  Fly   473 CPHSFVTKAELTSHARTHTGDKPFECEVCLARFTTSCSLAKHKRKHTGERPYACDLCPMRFTALN 537

Human   396 ALKKH 400
            .||.|
  Fly   538 VLKNH 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZBTB6NP_006617.1 BTB_POZ_ZBTB6 8..123 CDD:349506 4/6 (67%)
C2H2 Zn finger 303..323 CDD:275368 4/19 (21%)
zf-C2H2 326..348 CDD:395048 12/49 (24%)
C2H2 Zn finger 328..348 CDD:275368 11/47 (23%)
zf-C2H2_8 331..401 CDD:406359 34/98 (35%)
zf-H2C2_2 340..364 CDD:404364 12/51 (24%)
C2H2 Zn finger 356..376 CDD:275368 8/19 (42%)
C2H2 Zn finger 384..401 CDD:275368 7/17 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..424
CG6654NP_650429.1 zf-AD 6..79 CDD:285071
C2H2 Zn finger 331..354 CDD:275368 2/22 (9%)
COG5048 <357..570 CDD:227381 51/192 (27%)
C2H2 Zn finger 360..380 CDD:275368 2/19 (11%)
C2H2 Zn finger 385..406 CDD:275370 3/26 (12%)
C2H2 Zn finger 414..434 CDD:275368 4/19 (21%)
zf-H2C2_2 427..451 CDD:290200 9/23 (39%)
C2H2 Zn finger 442..490 CDD:275368 11/47 (23%)
C2H2 Zn finger 470..487 CDD:275368 0/16 (0%)
zf-H2C2_2 482..507 CDD:290200 11/24 (46%)
C2H2 Zn finger 498..518 CDD:275368 8/19 (42%)
zf-H2C2_2 510..534 CDD:290200 10/23 (43%)
C2H2 Zn finger 526..546 CDD:275368 7/17 (41%)
zf-H2C2_2 539..563 CDD:290200 3/4 (75%)
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.