DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rdh1 and Adhr

DIOPT Version :9

Sequence 1:NP_536684.2 Gene:Rdh1 / 107605 MGIID:1195275 Length:317 Species:Mus musculus
Sequence 2:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster


Alignment Length:196 Identity:49/196 - (25%)
Similarity:78/196 - (39%) Gaps:63/196 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse   122 NEWMKKQDFARVL----------------DVNLLGMIEVTLSMLPLV-RK---ARGRVVNVSSVM 166
            :|.|.:.|:..||                :.||.||:....::||.: ||   ..|.:|||:||:
  Fly    77 DEVMVQMDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVI 141

Mouse   167 G-RMSFFGGGYCISKYGVEAFSDSLRRELSYF--GVKVAIIEPGGFKTCV------------TSS 216
            | ..|.....|..||:||..|:.||...|.|.  ||.|..:..|..:..|            :.:
  Fly   142 GLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDRELKAFLEYGQSFA 206

Mouse   217 DRL--------------------SSNTKMIW--DKASSEVKEIY-----GEKFLLFYLKNLNELD 254
            |||                    .|....||  ||...|:.:::     .::| :.|:::.:|.|
  Fly   207 DRLRRAPCQSTSVCGQNIVNAIERSENGQIWIADKGGLELVKLHWYWHMADQF-VHYMQSNDEED 270

Mouse   255 K 255
            :
  Fly   271 Q 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rdh1NP_536684.2 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 49/196 (25%)
adh_short 30..211 CDD:278532 35/111 (32%)
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 45/170 (26%)
adh_short 7..195 CDD:278532 36/117 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.