DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BOLA2-SMG1P6 and MEC1

DIOPT Version :9

Sequence 1:NP_001307551.1 Gene:BOLA2-SMG1P6 / 107282092 HGNCID:53563 Length:305 Species:Homo sapiens
Sequence 2:NP_009694.3 Gene:MEC1 / 852433 SGDID:S000000340 Length:2368 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:59/258 - (22%)
Similarity:99/258 - (38%) Gaps:74/258 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    73 YLREK-LQRDLEAEHVLPSPGGVGQVRGET----AASETQVLYRVM---RCVTAANQVFFSEAVL 129
            |||.| .:|.::.     :|..|||....|    |..:|...:|.:   .|...|          
Yeast  1068 YLRRKQTERSIDF-----TPKKVGQTSDITLVLGALLDTSHKFRNLDKDLCEKCA---------- 1117

Human   130 TAANECVGVLLGSLDPSMTIHCDMVITYGLDQL----ENCQTCGTDYIISVLNLLTLIVEQINTK 190
                :|:. ::|.||  :|.|.....||..:::    ::.||  ..::|.|:|.: |:.....::
Yeast  1118 ----KCIS-MIGVLD--VTKHEFKRTTYSENEVYDLNDSVQT--IKFLIWVINDI-LVPAFWQSE 1172

Human   191 LPSSFVEKLFIPSSKLLFLRY-----------HKEKEVVAVAHAVY--QAMLSLKNIPVLETAYK 242
            .||   ::||:.......|:|           |||         :|  :|.|..|...|.:|   
Yeast  1173 NPS---KQLFVALVIQESLKYCGLSSESWDMNHKE---------LYPNEAKLWEKFNSVSKT--- 1222

Human   243 LILGEMTCALNNLLHSLQLPEACSEIKHEAFKNHVFNVDNAKFVVKFDLSALTTIGNAKNSSL 305
                    .:..||.||.|.::..|.....:.::.|......:|.:|.|..|.| |..:|..|
Yeast  1223 --------TIYPLLSSLYLAQSWKEYVPLKYPSNNFKEGYKIWVKRFTLDLLKT-GTTENHPL 1276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BOLA2-SMG1P6NP_001307551.1 None
MEC1NP_009694.3 TEL1 194..2368 CDD:227365 59/258 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.