DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BOLA2-SMG1P6 and pik1

DIOPT Version :9

Sequence 1:NP_001307551.1 Gene:BOLA2-SMG1P6 / 107282092 HGNCID:53563 Length:305 Species:Homo sapiens
Sequence 2:NP_594842.1 Gene:pik1 / 2541887 PomBaseID:SPAC22E12.16c Length:851 Species:Schizosaccharomyces pombe


Alignment Length:65 Identity:18/65 - (27%)
Similarity:30/65 - (46%) Gaps:18/65 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   187 INTKLPSSFVEKLFIPSSKLLFLRYHKEKEVVAVAHAVYQAMLSLKNIPVLETAYK---LILGEM 248
            :|..||:.    :.||    |...||||     |:|.:.:  :..|...:|.:|.:   ||:.|:
pombe   292 LNNNLPAD----VNIP----LLRSYHKE-----VSHKIVR--IDPKEATILNSAERVPYLIMVEV 341

Human   249  248
            pombe   342  341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BOLA2-SMG1P6NP_001307551.1 None
pik1NP_594842.1 TEL1 <1..851 CDD:227365 18/65 (28%)
PI3Ka <29..103 CDD:294194
Pik1 110..160 CDD:288387
PI4Kc_III_beta 549..851 CDD:270712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.