powered by:
Protein Alignment BOLA2-SMG1P6 and pik1
DIOPT Version :9
Sequence 1: | NP_001307551.1 |
Gene: | BOLA2-SMG1P6 / 107282092 |
HGNCID: | 53563 |
Length: | 305 |
Species: | Homo sapiens |
Sequence 2: | NP_594842.1 |
Gene: | pik1 / 2541887 |
PomBaseID: | SPAC22E12.16c |
Length: | 851 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 65 |
Identity: | 18/65 - (27%) |
Similarity: | 30/65 - (46%) |
Gaps: | 18/65 - (27%) |
- Green bases have known domain annotations that are detailed below.
Human 187 INTKLPSSFVEKLFIPSSKLLFLRYHKEKEVVAVAHAVYQAMLSLKNIPVLETAYK---LILGEM 248
:|..||:. :.|| |...|||| |:|.:.: :..|...:|.:|.: ||:.|:
pombe 292 LNNNLPAD----VNIP----LLRSYHKE-----VSHKIVR--IDPKEATILNSAERVPYLIMVEV 341
Human 249 248
pombe 342 341
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5032 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.