DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTGES3 and p23

DIOPT Version :9

Sequence 1:XP_016874205.1 Gene:PTGES3 / 10728 HGNCID:16049 Length:165 Species:Homo sapiens
Sequence 2:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster


Alignment Length:153 Identity:42/153 - (27%)
Similarity:69/153 - (45%) Gaps:9/153 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     7 PASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSD-NFKHLNEIDLFHCIDPNDSKH 70
            |....|..|.|.:::...|| .||:.....:...||..:...| :.|:...::..|.:||.....
  Fly     9 PPPVSWAQRNDLIYVIIDVE-CKDIEHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDPEKVTS 72

Human    71 KRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMG 135
            |...|.:...:.|..:|..|..||.::.||::|..:|..|:|..||.:.|..:...|...:|:.|
  Fly    73 KNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNFLNSPG 137

Human   136 GD-----ED--VDLPEVDGADDV 151
            ||     :|  ||..|.|..|::
  Fly   138 GDWNNKFDDFNVDDEEEDSDDNI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTGES3XP_016874205.1 p23 7..113 CDD:107218 27/106 (25%)
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158261
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5279
Isobase 1 0.950 - 0 Normalized mean entropy S2530
OMA 1 1.010 - - QHG53619
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 1 1.000 - - oto91758
orthoMCL 1 0.900 - - OOG6_101574
Panther 1 1.100 - - LDO PTHR22932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.