DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Carns1 and CG18003

DIOPT Version :9

Sequence 1:XP_036017269.1 Gene:Carns1 / 107239 MGIID:2147595 Length:1033 Species:Mus musculus
Sequence 2:NP_001027401.1 Gene:CG18003 / 3771779 FlyBaseID:FBgn0061356 Length:366 Species:Drosophila melanogaster


Alignment Length:150 Identity:38/150 - (25%)
Similarity:59/150 - (39%) Gaps:44/150 - (29%)


- Green bases have known domain annotations that are detailed below.


Mouse   440 AVVCRIQGDRPLLSKVVCGVGRGDRPVRHHYTLPRTLRVALAQCGLEEE--AQVALLEQGIKE-- 500
            |:|..|  |.|:.     |..|.|  ||::::||..|.:|..| |::..  ...|:...||.|  
  Fly   152 ALVLTI--DAPIF-----GHRRAD--VRNNFSLPSHLSLANFQ-GVKATGVGNAAMGASGINEYV 206

Mouse   501 ------------------------AAEGALA---AVLALE---AGLSVEQRGGRQVHTDFLGVDL 535
                                    ..:|.|.   ||||.|   |||.|...|.||:.|....::.
  Fly   207 SSQFDPTITWKDIAWLKGITHLPIVVKGVLTAEDAVLAQEFGCAGLIVSNHGARQIDTVPASIEA 271

Mouse   536 VLTVIGRTLTPVVLKLNSGL 555
            :..::......:|:.|:.|:
  Fly   272 LPEIVKAVGDNLVVMLDGGI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Carns1XP_036017269.1 ATPgrasp_N 617..697 CDD:407962
PRK02186 688..>941 CDD:235010
CG18003NP_001027401.1 alpha_hydroxyacid_oxid_FMN 7..353 CDD:239203 38/149 (26%)
FMN_dh 17..359 CDD:279418 38/149 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.