DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBR1 and Doc2

DIOPT Version :9

Sequence 1:NP_006584.1 Gene:TBR1 / 10716 HGNCID:11590 Length:682 Species:Homo sapiens
Sequence 2:NP_648282.1 Gene:Doc2 / 39038 FlyBaseID:FBgn0035956 Length:469 Species:Drosophila melanogaster


Alignment Length:489 Identity:158/489 - (32%)
Similarity:222/489 - (45%) Gaps:99/489 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   195 TQPGLVPGKAQVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNISGLDPTAHYNIFVDVILA 259
            |.||:     ::.|.|..||.:||:..|||||||.||||||.:..::|||:..::|.:.::::..
  Fly    52 TLPGV-----EMTLQNDDLWKQFHQIGTEMIITKSGRRMFPSMRLSVSGLEDESNYCVLLEMVPI 111

Human   260 DPNHWRFQGGKWVPCGKADTNVQGNRVYMHPDSPNTGAHWMRQEISFGKLKLTNNKGASNNNGQM 324
            ....::|.|.:|||.|.|:.. ...|:|:|||||.|||||..|.|.|.|:|||||  ..:|:|. 
  Fly   112 GDCRYKFSGSQWVPAGGAEPQ-SPQRMYLHPDSPATGAHWQAQPILFNKVKLTNN--TLDNSGH- 172

Human   325 VVLQSLHKYQPRLHVVEVNEDGTEDTSQ-P-GRVQTFTFPETQFIAVTAYQNTDITQLKIDHNPF 387
            :||.|:|||||||||:.     |.|.:| | ...|.|.|.||:|:|||||||..||:||||:|||
  Fly   173 IVLASMHKYQPRLHVIR-----TADLAQIPWAPQQAFVFAETEFVAVTAYQNDRITKLKIDNNPF 232

Human   388 AKGFRD--------NYDTIYTGCDMDRL-----TPSPNDSPRSQIVPGARYAMAGSFLQDQFVSN 439
            |||||:        ...:..||.|.|:.     :.|.::|..|....|...|...|.:.|.....
  Fly   233 AKGFRETGQSRCKRKMSSSPTGEDQDQSPSLSHSQSQSESDMSPTKGGGETAGGTSSIGDSDGPQ 297

Human   440 YAKARFHPGAGAGPGPGTDRSVPHTNGLL---SPQQAEDPGAPSPQRWFVTPANNRLDFAASAYD 501
            ..:.|.:..|.:......|:|||..:.|.   .|........|.|.:            |.||..
  Fly   298 IKRLRSNGSACSLSSSLDDQSVPGASSLALGSPPPHLHSHSHPHPLQ------------ARSASS 350

Human   502 T-ATDFAGNAATLLSYAAAGVKALPLQAAGCT--GRPLGYYADPSGWGARSPPQYCGTKSGSVLP 563
            . ...|..|..:||..:        |....||  |||..|     |...::.|.|          
  Fly   351 VFMQHFQQNMQSLLRPS--------LVDLACTYFGRPHEY-----GGAIQASPMY---------- 392

Human   564 CWPNSAAAAARMAGANPYLGEEAEGLAAERSPLPPGAAEDAKPKDLSDSSWIETPSSIKSID--- 625
                 ..||...||..|:.|..          ||||         :|.:..|...|..:.::   
  Fly   393 -----PPAAMLQAGLGPHPGLN----------LPPG---------VSGADLISDESGAEELELDV 433

Human   626 SSDSGIYEQAKRRRISPADTPVSESSSPLKSEVL 659
            .|::...||:.:.:  |.:.|.:.|.....|.:|
  Fly   434 GSETSTLEQSTQEQ--PLEQPSTRSKGFSISAIL 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBR1NP_006584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..83
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..127
T-box_TBR1 203..393 CDD:410330 95/191 (50%)
T-box_assoc 418..680 CDD:406561 52/251 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..483 9/38 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 588..658 14/72 (19%)
Doc2NP_648282.1 TBOX 55..242 CDD:238106 97/200 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3585
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11267
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.