DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CETN3 and cetn1

DIOPT Version :9

Sequence 1:NP_001284694.1 Gene:CETN3 / 1070 HGNCID:1868 Length:191 Species:Homo sapiens
Sequence 2:NP_001017149.1 Gene:cetn1 / 549903 XenbaseID:XB-GENE-967617 Length:172 Species:Xenopus tropicalis


Alignment Length:177 Identity:93/177 - (52%)
Similarity:124/177 - (70%) Gaps:27/177 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    14 TKRKK---RRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDR 75
            |:|||   :.||:|||||||::||:|||||....||..|||||||||||:.||.::.|::.|.|:
 Frog    14 TQRKKPVPKPELTEEQKQEIREAFDLFDTDGAGTIDVKELKVAMRALGFEPKKEEIKKMIADIDK 78

Human    76 EATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELR 140
            |.||||:|.||...:|..:.|:|..|||:|||:|||||::||||.:||:|||:|||||::||||:
 Frog    79 EGTGKISFGDFMSAMTQKMAEKDSKEEIMKAFRLFDDDETGKISFKNLKRVAKELGENLTDEELQ 143

Human   141 AMIEEFDKDGDGEILKNILLLPIWSRCLSLNREFFSEVNQEEFIAIM 187
            .||:|.|:||||                        |||::||:.||
 Frog   144 EMIDEADRDGDG------------------------EVNEQEFLRIM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CETN3NP_001284694.1 PTZ00183 15..190 CDD:185503 92/176 (52%)
cetn1NP_001017149.1 PTZ00183 16..172 CDD:185503 92/175 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D512630at33208
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.