DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CORIN and fz

DIOPT Version :9

Sequence 1:NP_006578.2 Gene:CORIN / 10699 HGNCID:19012 Length:1042 Species:Homo sapiens
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:153 Identity:56/153 - (36%)
Similarity:80/153 - (52%) Gaps:13/153 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   423 EGDQRCLYNPCLDS-----CGGSSLCDPNNSLNNC---SQCEPITLELCMNLPYNSTSYPNYFGH 479
            :|.||...:| ||:     .||..:......|:..   ::|||||:.:|.|:|||.|..||..||
  Fly    14 QGVQRYDQSP-LDASPYYRSGGGLMASSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGH 77

Human   480 RTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVL 544
            ..|:||.:  |...|..||:..|...|..|.|::.||.|.: ....|||||:||| |...||.::
  Fly    78 TKQEEAGL--EVHQFAPLVKIGCSDDLQLFLCSLYVPVCTI-LERPIPPCRSLCE-SARVCEKLM 138

Human   545 GIVGLQWPEDTDCSQFPEENSDN 567
            ......|||:.:||:||....::
  Fly   139 KTYNFNWPENLECSKFPVHGGED 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CORINNP_006578.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
DDNN motif 26..29
CRD_corin_1 135..263 CDD:143554
LDLa 269..304 CDD:238060
LDLa 306..340 CDD:238060
Ldl_recept_a 347..377 CDD:278486
LDLa 387..414 CDD:238060
CRD_corin_2 454..575 CDD:143579 47/114 (41%)
LDLa 580..614 CDD:238060
LDLa 655..689 CDD:238060
SR 690..786 CDD:214555
Tryp_SPc 801..1030 CDD:214473
Tryp_SPc 802..1033 CDD:238113
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 47/115 (41%)
Frizzled 237..564 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.