DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FUT9 and FucTA

DIOPT Version :9

Sequence 1:NP_006572.2 Gene:FUT9 / 10690 HGNCID:4020 Length:359 Species:Homo sapiens
Sequence 2:NP_001261872.1 Gene:FucTA / 39653 FlyBaseID:FBgn0036485 Length:503 Species:Drosophila melanogaster


Alignment Length:295 Identity:96/295 - (32%)
Similarity:138/295 - (46%) Gaps:52/295 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    88 IQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWM--NLESPTHTPQKSGIEH 150
            :..|.||.:|.|.:.:..:|.....|...:      .||...|.:.|  .||.|.|| |...:..
  Fly   202 VDTCELTANRDLASTADMILYKDHYIPTGI------RRPSNSKQVSMLYYLECPYHT-QNVKVPD 259

Human   151 LFNLTLTYRRDSDIQVPY--------------GFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHA 201
            ..|.|.||||||.|..||              ..:..|.|        |.|.|.|.|||....:.
  Fly   260 AINWTATYRRDSTIVAPY
EKWQYYDTKVQQQEQDINYSVN--------KTKKVAWFVSNCGARNG 316

Human   202 RVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTC--------KFYLSFENSIHKDYITEKLY 258
            |::|.:||.|.||:..|| |.|.:...::   |...|        ||||:||||..|||||||.:
  Fly   317 RLQYAHELQKYIEVDIYG-ACGNFKCSRS---TADKCFEILDNDYKFYLAFENSNCKDYITEKFF 377

Human   259 -NAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDF 322
             ||.....:|:|:|...|:||...|..|:|||::::||.|||:||:.:|.:::||.|||.|:...
  Fly   378 VNALNRRVLPIVMGARPEDYEVSAPRRSYIHVDEFSSPKELAEYLRILDHDDELYNSYFKWKGTG 442

Human   323 TVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF 357
            ......:|    |..|..:...::.:.    .:|:
  Fly   443 EFINTYYW----CRVCATLHNEEQLRK----PRWY 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FUT9NP_006572.2 Glyco_tran_10_N 62..169 CDD:407214 28/96 (29%)
Glyco_transf_10 185..354 CDD:395683 65/177 (37%)
FucTANP_001261872.1 Glyco_tran_10_N 173..277 CDD:293644 26/81 (32%)
Glyco_transf_10 300..473 CDD:279224 66/182 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5576
eggNOG 1 0.900 - - E1_KOG2619
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4402
Isobase 1 0.950 - 0 Normalized mean entropy S6520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394490at33208
OrthoFinder 1 1.000 - - FOG0000215
OrthoInspector 1 1.000 - - mtm8516
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11929
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3232
SonicParanoid 1 1.000 - - X114
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.