DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oard1 and CG33056

DIOPT Version :9

Sequence 1:NP_001276419.1 Gene:Oard1 / 106821 MGIID:2146818 Length:152 Species:Mus musculus
Sequence 2:NP_788556.1 Gene:CG33056 / 326246 FlyBaseID:FBgn0053056 Length:343 Species:Drosophila melanogaster


Alignment Length:141 Identity:66/141 - (46%)
Similarity:95/141 - (67%) Gaps:2/141 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 RITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKRFGGVQELLSQQKKSGEVAVLKRDGRY 77
            :||..:|:||:.|:..:|.|.:|.|..|.|||.:.|:.:||.|.||..|.|.:|.||||::|||:
  Fly   160 QITEARGNLFSAPENYALVHSVSADFAMCAGINLQFRCKFGQVDELKRQHKHTGNVAVLEQDGRH 224

Mouse    78 IYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAILEEVF-- 140
            ||.|:||:|:..|.||..|..:|.||:.|..::|||.|::||:|||:|||.|..|.::|:.||  
  Fly   225 IYNLVTKERSHEKCTYAALYYALLAMREHMREHGVTKLAIPRLGCGIDRLDWLRVRSLLDLVFAE 289

Mouse   141 ESTDIKITVYT 151
            :|.||....||
  Fly   290 DSVDIIAFFYT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Oard1NP_001276419.1 Macro_Poa1p-like 13..143 CDD:394873 61/131 (47%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9Y530 119..125 4/5 (80%)
CG33056NP_788556.1 Macro_Poa1p_like 5..136 CDD:239230
Macro_Poa1p_like 160..289 CDD:239230 61/128 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - O PTHR12521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.700

Return to query results.
Submit another query.