DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CETN1 and Cetn1

DIOPT Version :9

Sequence 1:NP_004057.1 Gene:CETN1 / 1068 HGNCID:1866 Length:172 Species:Homo sapiens
Sequence 2:NP_445913.1 Gene:Cetn1 / 84592 RGDID:620246 Length:172 Species:Rattus norvegicus


Alignment Length:172 Identity:155/172 - (90%)
Similarity:163/172 - (94%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPR 65
            |||.|:|.:.|||..|:||.|||||||||||||||||||||.|||||||.|||||||||||||||
  Rat     1 MASTFRKSNVASTSYKKKVGPKPELTEDQKQEVREAFDLFDSDGSGTIDVKELKVAMRALGFEPR 65

Human    66 KEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVA 130
            ||||||||||||:|.|||||||||||||||||:||||||||||||||||||||||||||||||||
  Rat    66 KEEMKKMISEVDKEATGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGKISFKNLKRVA 130

Human   131 NELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY 172
            |||||:|||||||||||||||||||||||||||:|||||:||
  Rat   131 NELGESLTDEELQEMIDEADRDGDGEVNEEEFLKIMKKTNLY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CETN1NP_004057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 20/29 (69%)
PTZ00183 22..172 CDD:185503 141/149 (95%)
Cetn1NP_445913.1 PTZ00183 15..172 CDD:185503 145/156 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83684903
Domainoid 1 1.000 126 1.000 Domainoid score I37060
eggNOG 1 0.900 - - E2759_KOG0028
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H105668
Inparanoid 1 1.050 307 1.000 Inparanoid score I14543
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - oto143904
orthoMCL 1 0.900 - - OOG6_101416
Panther 1 1.100 - - LDO PTHR23050
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X601
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1818.270

Return to query results.
Submit another query.