DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CETN1 and CG17493

DIOPT Version :9

Sequence 1:NP_004057.1 Gene:CETN1 / 1068 HGNCID:1866 Length:172 Species:Homo sapiens
Sequence 2:NP_001036396.2 Gene:CG17493 / 3355126 FlyBaseID:FBgn0040010 Length:182 Species:Drosophila melanogaster


Alignment Length:166 Identity:118/166 - (71%)
Similarity:145/166 - (87%) Gaps:1/166 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     8 PSAASTGQ-KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKK 71
            |:...|.| ::|..||.||:|.||.:::|||||||.:|:|.|:.||||||:|||||||:|||:|:
  Fly    17 PAKRGTQQGRKKSGPKFELSEAQKCDIKEAFDLFDNEGTGYIEVKELKVAIRALGFEPKKEEIKR 81

Human    72 MISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGEN 136
            |||::|::.:|:|:||.||.:||.||:||||||||||||||||||:||||||:||||||.||||.
  Fly    82 MISDIDKDCSGRIAFNVFLQLMTIKMAEKDTKEEILKAFRLFDDDDTGKISFRNLKRVARELGET 146

Human   137 LTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY 172
            ||||||:|||||||.|.|||||:|||||||||||||
  Fly   147 LTDEELREMIDEADLDNDGEVNQEEFLRIMKKTSLY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CETN1NP_004057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 10/23 (43%)
PTZ00183 22..172 CDD:185503 111/149 (74%)
CG17493NP_001036396.2 PTZ00183 26..182 CDD:185503 113/155 (73%)
EFh 42..104 CDD:238008 37/61 (61%)
EFh 115..177 CDD:238008 53/61 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147877
Domainoid 1 1.000 114 1.000 Domainoid score I6087
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I3383
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1382571at2759
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 1 1.000 - - otm40754
orthoMCL 1 0.900 - - OOG6_101416
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.