DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CETN1 and cdc31

DIOPT Version :9

Sequence 1:NP_004057.1 Gene:CETN1 / 1068 HGNCID:1866 Length:172 Species:Homo sapiens
Sequence 2:NP_587797.1 Gene:cdc31 / 2539261 PomBaseID:SPCC1682.04 Length:176 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:85/165 - (51%)
Similarity:116/165 - (70%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     6 KKPSAASTGQKRKV---AP-KPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRK 66
            |:.|.||:....::   || :.|:||:|:|::.|||.|||.|....||..||:.|||||||...|
pombe     8 KRRSRASSPTPARLGGYAPLRVEITEEQRQDINEAFKLFDSDKDNAIDYHELRAAMRALGFNAEK 72

Human    67 EEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVAN 131
            .|:.|::.:.|:.|.|.:...||:.|||:|:.|:|..|||.:||.|||||||||||.:||:|||.
pombe    73 SEVLKILRDFDKTGKGYLQMEDFVRVMTEKIVERDPLEEIKRAFELFDDDETGKISLRNLRRVAK 137

Human   132 ELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIM 166
            ||.||:.|:||:.||:|.|.|.|||:||:||:.||
pombe   138 ELNENIDDQELEAMIEEFDLDQDGEINEQEFIAIM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CETN1NP_004057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 10/28 (36%)
PTZ00183 22..172 CDD:185503 79/145 (54%)
cdc31NP_587797.1 PTZ00183 28..172 CDD:185503 77/143 (54%)
EFh 38..100 CDD:238008 27/61 (44%)
EFh 111..173 CDD:238008 41/62 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoFinder 1 1.000 - - FOG0000932
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R179
SonicParanoid 1 1.000 - - X601
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.