DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD226 and DIP-eta

DIOPT Version :9

Sequence 1:NP_001290547.1 Gene:CD226 / 10666 HGNCID:16961 Length:336 Species:Homo sapiens
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:395 Identity:74/395 - (18%)
Similarity:134/395 - (33%) Gaps:129/395 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    26 SVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNN 90
            :.|...:..|.||...:|.. :|.|.::.||    .|.:..:.::.:.   :|:...||  ....
  Fly    53 TAPVGRDAFLTCVVQDLGPY-KVAWLRVDTQ----TILTIQNHVITKN---QRIGIANS--EHKT 107

Human    91 MTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQ-VVQSDSFEAAVPSNSHIVSEPGKNVTLTC-- 152
            .|:..::..|.|.|:|.|.:.|.|..:....:. ||..|..:  .|:::.:|...|.||||.|  
  Fly   108 WTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILD--YPTSTDMVVREGSNVTLKCAA 170

Human   153 ----QPQMTW------PVQAVRWEKIQ--------------------------------PRQIDL 175
                :|.:||      |::....|::.                                .::|.|
  Fly   171 TGSPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITL 235

Human   176 LTY-----------CNLVHGRNFT-----SKFPR----------QIVSNCSHGRWSVIV------ 208
            :.:           ...|.|:..|     ..:|:          :||.  ..|::|..|      
  Fly   236 VVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVP--PGGKYSANVTEIGGY 298

Human   209 -------IPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVIS 266
                   |..:|.::.|.|||..:.|.|:.:                       ||:.|.....:
  Fly   299 RNSMRLHINPLTQAEFGSYRCVAKNSLGDTD-----------------------GTIKLYRIPPN 340

Human   267 ITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMD-----DTREDIYVNYP 326
            ....:..| ..|.:.::|...:||....:|..:  |......|..:..|     ::.:.||.|..
  Fly   341 AVNYVENF-EARHKGKKRTKSSESHHPARAQEH--SGEDMENPGKRKADLSLGAESIDSIYGNSA 402

Human   327 TFSRR 331
            ..|||
  Fly   403 AGSRR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD226NP_001290547.1 Ig 31..127 CDD:299845 22/96 (23%)
Ig 136..240 CDD:299845 31/186 (17%)
IG_like 138..240 CDD:214653 31/184 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316 3/23 (13%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 21/97 (22%)
IG_like 51..137 CDD:214653 21/93 (23%)
IG_like 153..237 CDD:214653 14/83 (17%)
Ig 161..224 CDD:299845 11/62 (18%)
IG_like 252..335 CDD:214653 19/107 (18%)
Ig 258..333 CDD:143165 17/99 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.