DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DMRT2 and dmrt93B

DIOPT Version :9

Sequence 1:NP_001374487.1 Gene:DMRT2 / 10655 HGNCID:2935 Length:561 Species:Homo sapiens
Sequence 2:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster


Alignment Length:380 Identity:101/380 - (26%)
Similarity:147/380 - (38%) Gaps:138/380 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    87 RPPLAPQASPAGTGPRERCTPAGGGAEPRKLSRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCAN 151
            ||.|.  |:|..|...|. |||      :..:|.||||||||||::|.|:|||:.|.:::|:||.
  Fly    16 RPRLV--ANPKATKIVEP-TPA------KVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAK 71

Human   152 CLLVVERQRVMAAQVALRRQQATEDKKGLSGKQNNFERKAVYQRQVRAPSLLAKSILEGYRPIPA 216
            |:|:.||||:|||||||:||||.||              |:..|      |:|.........:|.
  Fly    72 CVLIFERQRIMAAQVALKRQQAVED--------------AIAMR------LVANKTGRSIDALPP 116

Human   217 ETYVGGTFPLPPPVSDRMRKRRAFADKELENIMLERE---YKEREMLETSQAAALFLPNRMVPGP 278
            ....|.|  :..|.|.|.::.    |.::|..:.|.|   .|:||                    
  Fly   117 GNIFGLT--VTQPSSPRAKRE----DDQVEKTISEVEQQHLKQRE-------------------- 155

Human   279 DYNSYKSAYSPSP-----VEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLS 338
                  ..||.||     :..|.:|  |...|.:|:..|.                     :|..
  Fly   156 ------EEYSESPAVAQDLSAPRRD--NVSQTAIDMLAQL---------------------FPQR 191

Human   339 SRFLVWPKCGPISDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDM----MPSKLE 399
            .|.::         .|:.::|.|:...:::.:.|            .|.|:..|:    :||:..
  Fly   192 KRSVL---------ELVLKRCDLDLIRAIENVSP------------TGKSSPVDVTSNQLPSQEP 235

Human   400 GSLVLPHTPEIQTTRSDLQGHQAVPERSAFSPPRRNFSPIVDTDSLAAQGHVLTK 454
            |.|.....|             |.|..|||.|        |.||...::..|..|
  Fly   236 GMLTTMPQP-------------APPRSSAFRP--------VITDQYQSKSVVELK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DMRT2NP_001374487.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 10/31 (32%)
DM 119..165 CDD:395608 28/45 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..435 6/20 (30%)
dmrt93BNP_524428.1 DM 39..85 CDD:279137 28/45 (62%)
CUE_DMA 176..214 CDD:270553 8/67 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.