DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DMRT2 and dsx

DIOPT Version :9

Sequence 1:NP_001374487.1 Gene:DMRT2 / 10655 HGNCID:2935 Length:561 Species:Homo sapiens
Sequence 2:NP_001262353.1 Gene:dsx / 40940 FlyBaseID:FBgn0000504 Length:572 Species:Drosophila melanogaster


Alignment Length:162 Identity:52/162 - (32%)
Similarity:77/162 - (47%) Gaps:35/162 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    59 AEEEGDGEEAGASPGMPGQPEQRGGPQPRPPLAPQASPAGTGPRERCTPAGGGAEPRKLSRTPKC 123
            :||..:.:....|..:..:.:..||       |..:|.:...||   ||             |.|
  Fly     3 SEENWNSDTMSDSDMIDSKNDVCGG-------ASSSSGSSISPR---TP-------------PNC 44

Human   124 ARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSGKQNNFE 188
            |||||||:...||||||:|::|.|.|..|.|..:||||||.|.||||.||.:            |
  Fly    45 ARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQD------------E 97

Human   189 RKAVYQRQVRAPSLLAKSILEGYRPIPAETYV 220
            ::|::..:|...:..|.::|..:..:.|..:|
  Fly    98 QRALHMHEVPPANPAATTLLSHHHHVAAPAHV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DMRT2NP_001374487.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 11/59 (19%)
DM 119..165 CDD:395608 27/45 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..435
dsxNP_001262353.1 DM 41..86 CDD:279137 28/57 (49%)
DSX_dimer 353..404 CDD:285978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.