DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG42465

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001162864.1 Gene:CG42465 / 8674015 FlyBaseID:FBgn0259955 Length:73 Species:Drosophila melanogaster


Alignment Length:42 Identity:14/42 - (33%)
Similarity:17/42 - (40%) Gaps:14/42 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    61 GSC----QLFVY----------GGCDGNSNNYLTKEECLKKC 88
            |||    .|:.|          .||..|.|::..||||...|
  Fly    30 GSCLELTDLYSYVEYKNDCVYWQGCLLNGNHFSKKEECEDMC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 13/40 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
CG42465NP_001162864.1 Kunitz-type 21..71 CDD:444694 13/40 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.