DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and spint2

DIOPT Version :9

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001039077.1 Gene:spint2 / 733874 XenbaseID:XB-GENE-947329 Length:394 Species:Xenopus tropicalis


Alignment Length:288 Identity:97/288 - (33%)
Similarity:137/288 - (47%) Gaps:75/288 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    33 SIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATG 97
            ::.||||...|.|.|||:..|||||....:|:.|.||||.||.||::.:|.|:.|||.||...:.
 Frog   114 TLKDFCLPEAVTGPCRAAFERWWYNPNTQTCENFTYGGCKGNLNNHIGEEVCMNKCAGVTAEMSN 178

Human    98 DL--ATSRNAADSSVP-------------SAPRRQ-DSEDHSSDMFNY----------------- 129
            |:  .:.|.|..:|.|             |.||.. |:|..:...|.|                 
 Frog   179 DILPPSKRMAEANSDPACTGKGVIGNCRASFPRWYFDAESQNCISFTYGGCGGTENNHKSVQECA 243

Human   130 ---------------------EEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSY 173
                                 .|||.|.::||||||||.|||:||...:|..|.|||||||||:|
 Frog   244 DRCIVSKPEPAKVQAPMTGSFSEYCAAPSLTGPCRASFRRWYYDVTTATCVAFTYGGCRGNKNNY 308

Human   174 RSEEACMLRCFRQQEN-------------PPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVAR 225
            .|.|.|:..|..:.::             ..:.|.:.:.:|||:.::|:|       |:.:::|:
 Frog   309 LSVEDCVKNCAGRLDDDHTSDQTVLHRSITAVVLPALLAILAGILLLVMI-------VFFVKMAK 366

Human   226 RNQERA-LRTVWSSGDDKEQLVKNTYVL 252
            :||..| ...:||..||||.|:.|.|.|
 Frog   367 KNQRDAHFGAIWSPIDDKECLMNNAYTL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_BPTI 37..88 CDD:394972 25/50 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122 9/35 (26%)
Kunitz_BPTI 132..183 CDD:394972 31/50 (62%)
spint2NP_001039077.1 MANEC 19..104 CDD:384556
Kunitz_BPTI 118..169 CDD:333766 25/50 (50%)
KU 194..247 CDD:238057 8/52 (15%)
KU 266..318 CDD:238057 32/51 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7955
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0010905
OrthoInspector 1 1.000 - - oto157199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3049
SonicParanoid 1 1.000 - - X8445
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.