DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG17380

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster


Alignment Length:53 Identity:22/53 - (41%)
Similarity:35/53 - (66%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   131 EYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRC 183
            |.|:..|..|||:.:|..:.:|::.|.|..||||||.||.|.:::::.|:|.|
  Fly    23 ERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665 21/51 (41%)
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.