DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG42827

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:81 Identity:27/81 - (33%)
Similarity:39/81 - (48%) Gaps:13/81 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    21 LLSGVLAADR---------ERSIHD----FCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCD 72
            |.:.:||.|.         ||..::    .||.|...|:|:.....|:||.....||:|:|..|.
  Fly    11 LATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCG 75

Human    73 GNSNNYLTKEECLKKC 88
            ||.|.:.|||.|::.|
  Fly    76 GNGNLFYTKESCVEFC 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 20/55 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.