DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG14298

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:36 Identity:18/36 - (50%)
Similarity:23/36 - (63%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


Human   148 RWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRC 183
            |||||  :..|..|.|.||.||:|.:.|:|:|..||
  Fly    76 RWYFD--KGVCKPFNYKGCNGNRNRFCSQESCDARC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665 16/34 (47%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 16/34 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.