DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG34276

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster


Alignment Length:72 Identity:25/72 - (34%)
Similarity:36/72 - (50%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    17 LGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTK 81
            :..||:..|....:..||...||....||:.:|.:..|:||.|...||.|::.|...|.||:.|:
  Fly     5 ISCLLILLVFCLQQSYSIKRRCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGASNGNNFNTQ 69

Human    82 EECLKKC 88
            ..|.|.|
  Fly    70 ARCHKIC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 19/51 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.