DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPINT2 and CG3604

DIOPT Version :10

Sequence 1:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens
Sequence 2:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster


Alignment Length:133 Identity:43/133 - (32%)
Similarity:63/133 - (47%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     4 LCGLRRSRAFLALLGSLLL-SGVLAAD--------------------RERSIHDFCLVSKVVGRC 47
            :| .|.|.:|:.....||| :|:.||.                    .|.::.:.|...|..|||
  Fly     1 MC-FRYSFSFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRC 64

Human    48 RASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRN---AADSS 109
            .|...|:.|||...||:.||||||.||.||:.:||:|.:.|...:..::.|..|.:|   |.::|
  Fly    65 FALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVSSTDSTTEQNSEVATETS 129

Human   110 VPS 112
            ..|
  Fly   130 TSS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122 5/16 (31%)
Kunitz_HAI2_2-like 131..183 CDD:438665
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 25/49 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.